Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2575
Gene name
Locationscaffold_210:23..1426
Strand+
Gene length (bp)1403
Transcript length (bp)1320
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01008 IF-2B Initiation factor 2 subunit family 5.4E-46 161 423

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09924|EI2BD_SCHPO Probable translation initiation factor eIF-2B subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif224 PE=1 SV=1 1 439 5.0E-77
sp|Q63186|EI2BD_RAT Translation initiation factor eIF-2B subunit delta OS=Rattus norvegicus GN=Eif2b4 PE=2 SV=1 40 434 4.0E-52
sp|P41111|EI2BD_RABIT Translation initiation factor eIF-2B subunit delta OS=Oryctolagus cuniculus GN=EIF2B4 PE=2 SV=2 24 434 8.0E-52
sp|Q61749|EI2BD_MOUSE Translation initiation factor eIF-2B subunit delta OS=Mus musculus GN=Eif2b4 PE=1 SV=2 118 434 2.0E-51
sp|Q9UI10|EI2BD_HUMAN Translation initiation factor eIF-2B subunit delta OS=Homo sapiens GN=EIF2B4 PE=1 SV=2 118 434 2.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09924|EI2BD_SCHPO Probable translation initiation factor eIF-2B subunit delta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif224 PE=1 SV=1 1 439 5.0E-77
sp|Q63186|EI2BD_RAT Translation initiation factor eIF-2B subunit delta OS=Rattus norvegicus GN=Eif2b4 PE=2 SV=1 40 434 4.0E-52
sp|P41111|EI2BD_RABIT Translation initiation factor eIF-2B subunit delta OS=Oryctolagus cuniculus GN=EIF2B4 PE=2 SV=2 24 434 8.0E-52
sp|Q61749|EI2BD_MOUSE Translation initiation factor eIF-2B subunit delta OS=Mus musculus GN=Eif2b4 PE=1 SV=2 118 434 2.0E-51
sp|Q9UI10|EI2BD_HUMAN Translation initiation factor eIF-2B subunit delta OS=Homo sapiens GN=EIF2B4 PE=1 SV=2 118 434 2.0E-50
sp|Q3T058|EI2BD_BOVIN Translation initiation factor eIF-2B subunit delta OS=Bos taurus GN=EIF2B4 PE=2 SV=1 24 434 2.0E-47
sp|Q54FM3|EI2BD_DICDI Translation initiation factor eIF-2B subunit delta OS=Dictyostelium discoideum GN=eif2b4 PE=3 SV=1 114 435 3.0E-47
sp|P12754|EI2BD_YEAST Translation initiation factor eIF-2B subunit delta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD2 PE=1 SV=1 114 394 5.0E-47
sp|Q54I81|EI2BA_DICDI Translation initiation factor eIF-2B subunit alpha OS=Dictyostelium discoideum GN=eif2b1 PE=3 SV=1 213 436 3.0E-11
sp|O57947|R15PI_PYRHO Ribose 1,5-bisphosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0208 PE=3 SV=1 197 435 1.0E-10
sp|Q8U4G6|R15PI_PYRFU Ribose 1,5-bisphosphate isomerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0122 PE=3 SV=2 182 435 2.0E-10
sp|Q57586|R15PI_METJA Ribose 1,5-bisphosphate isomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0122 PE=3 SV=1 197 435 2.0E-09
sp|Q9V281|R15PI_PYRAB Ribose 1,5-bisphosphate isomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01930 PE=3 SV=1 197 435 2.0E-09
sp|Q8U3J1|EI2BL_PYRFU Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0475 PE=3 SV=1 253 422 4.0E-09
sp|O28242|R15PI_ARCFU Ribose 1,5-bisphosphate isomerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_2037 PE=3 SV=1 195 422 8.0E-09
sp|Q5JFM9|R15PI_THEKO Ribose 1,5-bisphosphate isomerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0185 PE=1 SV=1 251 435 8.0E-09
sp|Q9UYB6|EI2BL_PYRAB Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB15920 PE=3 SV=1 253 424 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0044237 cellular metabolic process Yes
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2575
MAGETGQPAGDGADKKRKKEGQKQDATANEASPNKDKKLSNAELKKKAKEDKAARRAAAKSSQPSQPAAAPQLQP
PTPSGSEAKTSVASAASRARPKSHHDGGGGGTRPPKPKMPECFSHLSMARRLTLTQADKDVHPTVLALGQQMGCF
ALGDSITRLEATLMAFKKVIDAYTTPHGATFSRHFTSHVLNPQIEYLAACRPMCFSMGNAIRWLKLQISKLDIDL
PDSDAKKYLCALIDSFISERITLADFVIVNTAAEKVSDGDVVVVYGHHHLVQRTLLRARSDGRKFRVVVVDDAFQ
RVGYQLAKALAAAEIAVSYVSDLGALRTTLARATLVMTAAEAMFSNGAMYARAGTCDVATVAADVGLAVVVLCET
INFTDRVAIDSLTYNEIDPESCDDEGFRLLFDTTMHRYISVVVTELGTTSAKSVPAILRKLEEL
Coding >Ophio5|2575
ATGGCTGGCGAGACTGGCCAGCCGGCGGGCGACGGCGCCGACAAGAAGCGAAAGAAGGAGGGTCAAAAACAGGAT
GCCACAGCGAACGAAGCATCGCCCAACAAGGACAAGAAACTCTCCAACGCAGAGCTCAAGAAAAAGGCAAAGGAG
GACAAGGCGGCGAGACGAGCAGCAGCCAAATCAAGCCAGCCGTCCCAACCAGCAGCCGCCCCTCAGCTGCAACCA
CCGACGCCGTCCGGCAGCGAGGCAAAAACCAGCGTCGCCTCCGCCGCTTCCAGGGCTCGGCCCAAGTCGCATCAC
GATGGTGGTGGTGGCGGCACCCGCCCGCCCAAGCCCAAGATGCCCGAGTGCTTCAGCCACCTGTCGATGGCGCGG
CGCTTGACGCTCACGCAGGCTGACAAGGACGTCCATCCTACCGTGTTGGCGTTGGGGCAGCAAATGGGCTGCTTT
GCTCTTGGTGATAGCATCACCAGGCTCGAGGCTACTCTTATGGCCTTTAAAAAGGTCATCGATGCCTACACGACG
CCCCATGGCGCAACCTTCTCTCGACACTTTACGTCGCACGTCCTCAATCCTCAGATCGAATACCTCGCCGCCTGT
CGACCCATGTGCTTCTCCATGGGTAACGCCATTCGTTGGCTCAAGCTGCAAATCAGCAAGTTGGATATTGACCTG
CCGGACTCGGACGCCAAGAAATACCTCTGTGCGCTCATCGACAGCTTCATCAGCGAACGCATCACCCTCGCCGAC
TTCGTCATCGTCAACACGGCGGCCGAAAAGGTTTCCGACGGGGACGTCGTCGTCGTCTACGGTCATCATCATCTC
GTCCAACGTACCCTCCTTCGCGCCCGCTCCGACGGTCGAAAGTTTAGAGTCGTCGTCGTCGACGACGCCTTCCAA
CGGGTCGGCTACCAACTCGCAAAGGCTCTAGCCGCCGCCGAGATAGCCGTGAGCTACGTTTCCGATCTCGGCGCC
TTACGGACGACGCTCGCTCGCGCTACCTTGGTCATGACGGCCGCCGAGGCCATGTTCAGCAACGGCGCCATGTAC
GCCCGCGCCGGCACCTGCGACGTCGCCACCGTCGCGGCTGATGTTGGACTCGCCGTCGTCGTCCTCTGCGAGACT
ATCAACTTTACCGACCGTGTTGCCATCGACTCTCTCACCTATAACGAGATCGACCCGGAGAGCTGTGATGACGAG
GGCTTTCGTCTACTCTTCGATACTACCATGCATCGCTACATCTCCGTCGTCGTCACGGAGCTCGGCACGACTTCG
GCCAAGTCGGTACCGGCCATCCTGCGGAAACTGGAGGAGCTG
Transcript >Ophio5|2575
ATGGCTGGCGAGACTGGCCAGCCGGCGGGCGACGGCGCCGACAAGAAGCGAAAGAAGGAGGGTCAAAAACAGGAT
GCCACAGCGAACGAAGCATCGCCCAACAAGGACAAGAAACTCTCCAACGCAGAGCTCAAGAAAAAGGCAAAGGAG
GACAAGGCGGCGAGACGAGCAGCAGCCAAATCAAGCCAGCCGTCCCAACCAGCAGCCGCCCCTCAGCTGCAACCA
CCGACGCCGTCCGGCAGCGAGGCAAAAACCAGCGTCGCCTCCGCCGCTTCCAGGGCTCGGCCCAAGTCGCATCAC
GATGGTGGTGGTGGCGGCACCCGCCCGCCCAAGCCCAAGATGCCCGAGTGCTTCAGCCACCTGTCGATGGCGCGG
CGCTTGACGCTCACGCAGGCTGACAAGGACGTCCATCCTACCGTGTTGGCGTTGGGGCAGCAAATGGGCTGCTTT
GCTCTTGGTGATAGCATCACCAGGCTCGAGGCTACTCTTATGGCCTTTAAAAAGGTCATCGATGCCTACACGACG
CCCCATGGCGCAACCTTCTCTCGACACTTTACGTCGCACGTCCTCAATCCTCAGATCGAATACCTCGCCGCCTGT
CGACCCATGTGCTTCTCCATGGGTAACGCCATTCGTTGGCTCAAGCTGCAAATCAGCAAGTTGGATATTGACCTG
CCGGACTCGGACGCCAAGAAATACCTCTGTGCGCTCATCGACAGCTTCATCAGCGAACGCATCACCCTCGCCGAC
TTCGTCATCGTCAACACGGCGGCCGAAAAGGTTTCCGACGGGGACGTCGTCGTCGTCTACGGTCATCATCATCTC
GTCCAACGTACCCTCCTTCGCGCCCGCTCCGACGGTCGAAAGTTTAGAGTCGTCGTCGTCGACGACGCCTTCCAA
CGGGTCGGCTACCAACTCGCAAAGGCTCTAGCCGCCGCCGAGATAGCCGTGAGCTACGTTTCCGATCTCGGCGCC
TTACGGACGACGCTCGCTCGCGCTACCTTGGTCATGACGGCCGCCGAGGCCATGTTCAGCAACGGCGCCATGTAC
GCCCGCGCCGGCACCTGCGACGTCGCCACCGTCGCGGCTGATGTTGGACTCGCCGTCGTCGTCCTCTGCGAGACT
ATCAACTTTACCGACCGTGTTGCCATCGACTCTCTCACCTATAACGAGATCGACCCGGAGAGCTGTGATGACGAG
GGCTTTCGTCTACTCTTCGATACTACCATGCATCGCTACATCTCCGTCGTCGTCACGGAGCTCGGCACGACTTCG
GCCAAGTCGGTACCGGCCATCCTGCGGAAACTGGAGGAGCTGTGA
Gene >Ophio5|2575
ATGGCTGGCGAGACTGGCCAGCCGGCGGGCGACGGCGCCGACAAGAAGCGAAAGAAGGAGGGTCAAAAACAGGAT
GCCACAGCGAACGAAGCATCGCCCAACAAGGACAAGAAACTCTCCAACGCAGAGCTCAAGAAAAAGGCAAAGGAG
GACAAGGCGGCGAGACGAGCAGCAGCCAAATCAAGCCAGCCGTCCCAACCAGCAGCCGCCCCTCAGCTGCAACCA
CCGACGCCGTCCGGCAGCGAGGCAAAAACCAGCGTCGCCTCCGCCGCTTCCAGGGCTCGGCCCAAGTCGCATCAC
GATGGTGGTGGTGGCGGCACCCGCCCGCCCAAGCCCAAGATGCCCGAGTGCTTCAGCCACCTGTCGATGGCGCGG
CGCTTGACGCTCACGCAGGCTGACAAGGACGTCCATCCTACCGTGTTGGCGTTGGGGCAGCAAATGGGCTGCTTT
GCTCTTGGTGATAGCATCACCAGGCTCGAGGCTACTCTTATGGCCTTTAAAAAGGTTGCCCACACACACACACAT
AATTTGCCGAGACAGAATGGGCCCTCGCTAACGTCGTCGTCGTCTCATCATCGTCCACACAGGTCATCGATGCCT
ACACGACGCCCCATGGCGCAACCTTCTCTCGACACTTTACGTCGCACGTCCTCAATCCTCAGATCGAATACCTCG
CCGCCTGTCGACCCATGTGCTTCTCCATGGGTAACGCCATTCGTTGGCTCAAGCTGCAAATCAGCAAGTTGGATA
TTGACCTGCCGGACTCGGACGCCAAGAAATACCTCTGTGCGCTCATCGACAGCTTCATCAGCGAACGCATCACCC
TCGCCGACTTCGTCATCGTCAACACGGCGGCCGAAAAGGTTTCCGACGGGGACGTCGTCGTCGTCTACGGTCATC
ATCATCTCGTCCAACGTACCCTCCTTCGCGCCCGCTCCGACGGTCGAAAGTTTAGAGTCGTCGTCGTCGACGACG
CCTTCCAACGGGTCGGCTACCAACTCGCAAAGGCTCTAGCCGCCGCCGAGATAGCCGTGAGCTACGTTTCCGATC
TCGGCGCCTTACGGACGACGCTCGCTCGCGCTACCTTGGTCATGACGGCCGCCGAGGCCATGTTCAGCAACGGCG
CCATGTACGCCCGCGCCGGCACCTGCGACGTCGCCACCGTCGCGGCTGATGTTGGACTCGCCGTCGTCGTCCTCT
GCGAGACTATCAACTTTACCGACCGTGTTGCCATCGACTCTCTCACCTATAACGAGATCGACCCGGAGAGCTGTG
ATGACGAGGGCTTTCGTCTACTCTTCGATACTACCATGCATCGCTACATCTCCGTCGTCGTCACGGAGCTCGGCA
CGACTTCGGCCAAGTCGGTACCGGCCATCCTGCGGAAACTGGAGGAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail