Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2564
Gene name
Locationscaffold_21:59648..61600
Strand+
Gene length (bp)1952
Transcript length (bp)1608
Coding sequence length (bp)1605
Protein length (aa) 535

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 5.4E-53 49 508
PF00324 AA_permease Amino acid permease 3.0E-23 60 449

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 7 531 4.0E-67
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 22 534 1.0E-42
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 20 524 4.0E-42
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 32 523 1.0E-41
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 36 520 3.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19807|HNM1_YEAST Choline transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HNM1 PE=1 SV=1 7 531 4.0E-67
sp|O74537|YCQ4_SCHPO Uncharacterized amino-acid permease C74.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC74.04 PE=3 SV=1 22 534 1.0E-42
sp|O60113|YG64_SCHPO Uncharacterized amino-acid permease C15C4.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.04c PE=3 SV=1 20 524 4.0E-42
sp|Q09887|YC9D_SCHPO Uncharacterized amino-acid permease C584.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC584.13 PE=3 SV=1 32 523 1.0E-41
sp|Q9ZU50|BAT1_ARATH Amino-acid permease BAT1 OS=Arabidopsis thaliana GN=BAT1 PE=2 SV=2 36 520 3.0E-39
sp|Q9US40|YFZ1_SCHPO Uncharacterized amino-acid permease C1039.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.01 PE=3 SV=1 8 529 4.0E-39
sp|O59942|AAP2_NEUCR Amino-acid permease 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aap-2 PE=2 SV=2 34 521 4.0E-38
sp|B9EXZ6|BAT1_ORYSJ Amino-acid permease BAT1 homolog OS=Oryza sativa subsp. japonica GN=BAT1 PE=2 SV=1 36 501 2.0E-36
sp|P32837|UGA4_YEAST GABA-specific permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UGA4 PE=1 SV=1 23 521 4.0E-35
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO5 PE=1 SV=1 31 516 2.0E-31
sp|Q10087|YAO8_SCHPO Uncharacterized amino-acid permease C11D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.08c PE=3 SV=1 12 519 4.0E-31
sp|P53744|BIO5_YEAST 7-keto 8-aminopelargonic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIO5 PE=1 SV=1 23 512 2.0E-30
sp|O74248|GPT1_CANAX Putative polyamine transporter OS=Candida albicans GN=GPT1 PE=3 SV=1 32 529 1.0E-26
sp|Q9C0Z0|YKM2_SCHPO Uncharacterized amino-acid permease PB24D3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.02c PE=3 SV=1 31 519 1.0E-25
sp|O59813|YCT3_SCHPO Uncharacterized amino-acid permease C794.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.03 PE=2 SV=1 10 518 1.0E-24
sp|Q9UT18|THI9_SCHPO Thiamine transporter thi9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi9 PE=1 SV=1 16 514 2.0E-24
sp|P76037|PUUP_ECOLI Putrescine importer PuuP OS=Escherichia coli (strain K12) GN=puuP PE=1 SV=2 274 425 3.0E-09
sp|P0AA47|PLAP_ECOLI Low-affinity putrescine importer PlaP OS=Escherichia coli (strain K12) GN=plaP PE=1 SV=1 274 418 9.0E-07
sp|P0AA48|PLAP_ECO57 Low-affinity putrescine importer PlaP OS=Escherichia coli O157:H7 GN=plaP PE=3 SV=1 274 418 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 49 68 19
2 83 105 22
3 130 152 22
4 181 203 22
5 215 237 22
6 257 279 22
7 300 322 22
8 349 371 22
9 404 426 22
10 430 452 22
11 465 487 22
12 502 519 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 19.20 8.82 29.58
CcL In ants, during behavior modification 170.34 69.47 271.21
CcD In ants, recently dead 19.36 8.88 29.83

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.981386 no
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2564
MSSPSAVSPSEDNGAVVGDSRQDAALLQARRDAQDLADLGHDQALSRKFSLWSMLALALCVLGTWTTFAQGLSSG
LVHGGPIAILWGLVLVALCNGCVAISLGELCSSMPTALGQADWISRLLSGRGARFASYLCAWLNTFGWWTLSASQ
VAFMTDFILSMRLMFIQDDAAAAAARDALPGWQRFLVYLAVTLLFTLINVVSCRRESLLPIISNSVGVGFIGLFV
AFVVALPVAVATRPGRHFQPASFVFAGWINRTGWPDGVTWFVGLVQSAYGLTAFDSVIHMAEEIPAPRRNVPRTM
WLAVASGAVSGFVFMVVCLFCIQDVDRILSPTSGFPFIEISQSTLGRNAAAVLIGLFILNGLGQGFGILTSASRL
TWSFARDGGLPLSQYWAHVDPRWRVPARALWLQASLIGLVGLLYLFASTVLQAVLSVSTIALTLSYAMPIAALLL
AGRGALPSGQFRLGPRLGPIANGVSLVYCAITTVFFFFPGSPNPSPGDMNYAIAVFGVMVVVALAFWLLEGPRKR
QSRRTAFVSV
Coding >Ophio5|2564
ATGTCCTCTCCGTCTGCCGTCTCCCCCTCGGAAGACAATGGCGCCGTCGTCGGAGATTCTCGGCAAGATGCCGCC
CTTCTCCAGGCCCGTCGCGACGCTCAAGACCTCGCCGACCTCGGCCACGATCAGGCCCTCAGCCGCAAGTTTAGC
CTCTGGAGTATGCTCGCCCTCGCCCTCTGCGTCCTCGGCACCTGGACCACGTTTGCTCAGGGCCTCAGCAGCGGC
CTCGTTCACGGCGGTCCCATCGCTATTCTTTGGGGCCTCGTCCTCGTCGCTCTGTGCAATGGCTGCGTCGCCATC
TCTCTCGGGGAGCTGTGTAGCAGCATGCCGACGGCACTGGGACAGGCAGATTGGATATCGCGTCTTCTTAGTGGC
CGTGGCGCCCGCTTCGCTTCCTATCTCTGCGCCTGGCTCAATACGTTTGGATGGTGGACGCTCAGTGCGTCACAG
GTGGCCTTCATGACCGACTTTATCTTATCCATGCGCCTCATGTTCATCCAAGATGATGCCGCTGCTGCTGCTGCT
AGAGACGCACTGCCCGGCTGGCAGCGGTTTCTCGTCTACCTGGCCGTCACGCTACTCTTCACTCTCATCAATGTC
GTTTCATGCCGTCGCGAGTCGCTGCTACCCATCATCAGCAACTCTGTGGGCGTCGGCTTCATCGGCCTCTTCGTC
GCCTTCGTCGTCGCACTGCCAGTCGCCGTCGCAACCCGTCCGGGCCGACATTTCCAGCCGGCCTCGTTTGTCTTC
GCCGGCTGGATCAACCGCACGGGCTGGCCAGACGGCGTGACTTGGTTCGTCGGCCTCGTTCAGAGCGCCTACGGC
TTGACGGCTTTCGACTCCGTCATCCACATGGCCGAGGAGATTCCCGCGCCTCGACGCAACGTTCCGCGCACAATG
TGGCTGGCCGTCGCTTCCGGCGCCGTCTCCGGCTTCGTCTTCATGGTCGTCTGCCTTTTCTGCATCCAGGACGTC
GATCGGATATTGTCCCCGACTTCGGGCTTCCCCTTTATCGAAATCAGCCAGTCGACGCTTGGTCGCAACGCCGCC
GCCGTCCTCATTGGCCTTTTCATCCTCAACGGCCTCGGACAGGGTTTCGGCATCCTGACGTCTGCCTCTCGTCTG
ACGTGGAGCTTCGCCCGCGATGGTGGCCTACCCCTGAGTCAGTACTGGGCACACGTCGACCCACGTTGGCGCGTG
CCCGCCCGCGCCCTCTGGCTACAGGCGTCCCTCATCGGTCTCGTCGGCCTGCTGTACCTGTTCGCCAGCACGGTT
CTACAGGCGGTGCTCAGCGTCAGCACCATTGCGCTGACGCTGTCGTATGCCATGCCCATCGCCGCCCTGCTGCTG
GCCGGACGAGGGGCTCTTCCGTCGGGTCAGTTCCGGCTGGGCCCTCGACTGGGACCCATCGCCAATGGTGTCTCG
CTCGTTTACTGCGCCATCACCACCGTCTTCTTCTTCTTTCCCGGCTCGCCGAACCCGTCACCCGGTGATATGAAC
TACGCAATCGCCGTCTTTGGCGTCATGGTCGTCGTAGCCCTCGCCTTTTGGCTCCTCGAGGGGCCAAGAAAGAGG
CAAAGCAGACGGACAGCCTTCGTCTCAGTA
Transcript >Ophio5|2564
ATGTCCTCTCCGTCTGCCGTCTCCCCCTCGGAAGACAATGGCGCCGTCGTCGGAGATTCTCGGCAAGATGCCGCC
CTTCTCCAGGCCCGTCGCGACGCTCAAGACCTCGCCGACCTCGGCCACGATCAGGCCCTCAGCCGCAAGTTTAGC
CTCTGGAGTATGCTCGCCCTCGCCCTCTGCGTCCTCGGCACCTGGACCACGTTTGCTCAGGGCCTCAGCAGCGGC
CTCGTTCACGGCGGTCCCATCGCTATTCTTTGGGGCCTCGTCCTCGTCGCTCTGTGCAATGGCTGCGTCGCCATC
TCTCTCGGGGAGCTGTGTAGCAGCATGCCGACGGCACTGGGACAGGCAGATTGGATATCGCGTCTTCTTAGTGGC
CGTGGCGCCCGCTTCGCTTCCTATCTCTGCGCCTGGCTCAATACGTTTGGATGGTGGACGCTCAGTGCGTCACAG
GTGGCCTTCATGACCGACTTTATCTTATCCATGCGCCTCATGTTCATCCAAGATGATGCCGCTGCTGCTGCTGCT
AGAGACGCACTGCCCGGCTGGCAGCGGTTTCTCGTCTACCTGGCCGTCACGCTACTCTTCACTCTCATCAATGTC
GTTTCATGCCGTCGCGAGTCGCTGCTACCCATCATCAGCAACTCTGTGGGCGTCGGCTTCATCGGCCTCTTCGTC
GCCTTCGTCGTCGCACTGCCAGTCGCCGTCGCAACCCGTCCGGGCCGACATTTCCAGCCGGCCTCGTTTGTCTTC
GCCGGCTGGATCAACCGCACGGGCTGGCCAGACGGCGTGACTTGGTTCGTCGGCCTCGTTCAGAGCGCCTACGGC
TTGACGGCTTTCGACTCCGTCATCCACATGGCCGAGGAGATTCCCGCGCCTCGACGCAACGTTCCGCGCACAATG
TGGCTGGCCGTCGCTTCCGGCGCCGTCTCCGGCTTCGTCTTCATGGTCGTCTGCCTTTTCTGCATCCAGGACGTC
GATCGGATATTGTCCCCGACTTCGGGCTTCCCCTTTATCGAAATCAGCCAGTCGACGCTTGGTCGCAACGCCGCC
GCCGTCCTCATTGGCCTTTTCATCCTCAACGGCCTCGGACAGGGTTTCGGCATCCTGACGTCTGCCTCTCGTCTG
ACGTGGAGCTTCGCCCGCGATGGTGGCCTACCCCTGAGTCAGTACTGGGCACACGTCGACCCACGTTGGCGCGTG
CCCGCCCGCGCCCTCTGGCTACAGGCGTCCCTCATCGGTCTCGTCGGCCTGCTGTACCTGTTCGCCAGCACGGTT
CTACAGGCGGTGCTCAGCGTCAGCACCATTGCGCTGACGCTGTCGTATGCCATGCCCATCGCCGCCCTGCTGCTG
GCCGGACGAGGGGCTCTTCCGTCGGGTCAGTTCCGGCTGGGCCCTCGACTGGGACCCATCGCCAATGGTGTCTCG
CTCGTTTACTGCGCCATCACCACCGTCTTCTTCTTCTTTCCCGGCTCGCCGAACCCGTCACCCGGTGATATGAAC
TACGCAATCGCCGTCTTTGGCGTCATGGTCGTCGTAGCCCTCGCCTTTTGGCTCCTCGAGGGGCCAAGAAAGAGG
CAAAGCAGACGGACAGCCTTCGTCTCAGTATAA
Gene >Ophio5|2564
ATGTCCTCTCCGTCTGCCGTCTCCCCCTCGGAAGACAATGGCGCCGTCGTCGGAGATTCTCGGCAAGATGCCGCC
CTTCTCCAGGCCCGTCGCGACGCTCAAGACCTCGCCGACCTCGGCCACGATCAGGCCCTCAGCCGCAAGTTTAGC
CTCTGGAGTATGCTCGCCCTCGCCCTCTGCGTCCTCGGCACCTGGACCACGTTTGCTCAGGGCCTCAGCAGCGGC
CTCGTTCACGGCGGTCCCATCGCTATTCTTTGGGGCCTCGTCCTCGTCGCTCTGTGCAATGGCTGCGTCGCCATC
TCTCTCGGGGAGCTGTGTAGCAGCATGCCGACGGCACTGGGACAGGCAGATTGGATATCGCGTCTTCTTAGTGGC
CGTGGCGCCCGCTTCGCTTCCTATCTCTGCGCCTGGCTCAATACGTTTGGATGGTGGACGCTCAGTGCGTCACAG
GTGGCCTTCATGACCGACTTTATCTTATCCATGCGCCTCATGTTCATCCAAGATGATGCCGCTGCTGCTGCTGCT
AGAGACGCACTGCCCGGCTGGCAGCGGTTTCTCGTCTACCTGGCCGTCACGCTACTCTTCACTCTCATCAATGTC
GTTTCATGCCGTCGCGAGTCGCTGCTACCCATCATCAGCAACTCTGTGGGCGTCGGCTTCATCGGCCTCTTCGTC
GCCTTCGTCGTCGCACTGCCAGTCGCCGTCGCAACCCGTCCGGGCCGACATTTCCAGCCGGCCTCGTTTGTCTTC
GCCGGCTGGATCAACCGCACGGGCTGGCCAGACGGCGTGACTTGGTTCGTCGGCCTCGTTCAGAGCGCCTACGGC
TTGACGGCTTTCGACTCCGTCATCCACATGGCCGAGGAGATTCCCGCGCCTCGACGCAACGTTCCGCGCACAATG
TGGCTGGCCGTCGCTTCCGGCGCCGTCTCCGGCTTCGTCTTCATGGTCGTCTGCCTTTTCTGCATCCAGGACGTC
GATCGGATATTGTCCCCGACTTCGGGCTTCCCCTTTATCGAAATCAGCCAGTCGACGCTTGGTCGCAACGCCGCC
GCCGTCCTCATTGGCCTTTTCATCCTCAACGGCCTCGGACAGGGTTTCGGCATCCTGACGTCTGCCTCTCGTCTG
ACGTGGAGCTTCGCCCGCGATGGTGGCCTACCCCTGAGTCAGTACTGGGCACACGTCGACCCACGTTGGCGCGTG
CCCGCCCGCGCCCTCTGGCTACAGGCGTCCCTCATCGGTCTCGTCGGCCTGCTGTACCTGTTCGCCAGCACGGTT
CTACAGGCGGTGCTCAGCGTCAGCACCATTGCGCTGACGCTGTCGTATGCCATGCCCATCGCCGCCCTGCTGCTG
GCCGGACGAGGGGCTCTTCCGTCGGGTCAGTTCCGGCTGGGCCCTCGACTGGGACCCATCGCCAATGGTGTCTCG
CTCGTTTACTGCGCCATCACCACCGTCTTCTTCTTCTTTCCCGGCTCGCCGAACCCGTCACCCGGTGATATGAAC
TACGCAATCGCCGTCTTTGGCGTCATGGTCGTCGTAGCCCTCGCCTTTTGGCTCCTCGAGGGGCGTCACTCCTAC
AAGCGACCCGCCGGCCATGTGCTATACGCTCAGGACCCGGTCGAGACGGTCGACGACGGTGATGGTAAAGGTTCG
GCGAAGAAGTTATAGCAAGAAGTACGAGCGGTATTCTCTTCTTCTTTCCCCCCTACTCTTTTTCCTCCCTTGAGC
AACGATTGAAACGATTTTGTACGTGGAAATGAGTTAGAGAGGCAAAGCAGACGGACAGGTGAGCAGGATTTTCAA
CACCATTTCTTCATTGTTTTTTCTGTGGCCTTTCCCCTTTCATGGTAGTCCATGTCAAAGCCAGTCATGCAGAGA
ATGGCAACACCTCAACCACAGAGCCATGTTACAGCCGCGACCCCAAATTAACATGAACAGCCTTCGTCTCAGTAT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail