Protein ID | Ophio5|2562 |
Gene name | |
Location | scaffold_21:53324..54701 |
Strand | + |
Gene length (bp) | 1377 |
Transcript length (bp) | 1377 |
Coding sequence length (bp) | 1374 |
Protein length (aa) | 458 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF01040 | UbiA | UbiA prenyltransferase family | 3.0E-57 | 135 | 396 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q4I5G1|COX10_GIBZE | Protoheme IX farnesyltransferase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=COX10 PE=3 SV=1 | 30 | 422 | 0.0E+00 |
sp|P0C150|COX10_MAGO7 | Protoheme IX farnesyltransferase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=COX10 PE=3 SV=1 | 54 | 444 | 2.0E-175 |
sp|Q7S5E7|COX10_NEUCR | Protoheme IX farnesyltransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pft-1 PE=3 SV=2 | 113 | 422 | 1.0E-154 |
sp|Q4WP81|COX10_ASPFU | Protoheme IX farnesyltransferase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cox10 PE=3 SV=1 | 40 | 435 | 2.0E-126 |
sp|Q5BCK8|COX10_EMENI | Protoheme IX farnesyltransferase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cox10 PE=3 SV=1 | 63 | 423 | 2.0E-115 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q4I5G1|COX10_GIBZE | Protoheme IX farnesyltransferase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=COX10 PE=3 SV=1 | 30 | 422 | 0.0E+00 |
sp|P0C150|COX10_MAGO7 | Protoheme IX farnesyltransferase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=COX10 PE=3 SV=1 | 54 | 444 | 2.0E-175 |
sp|Q7S5E7|COX10_NEUCR | Protoheme IX farnesyltransferase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pft-1 PE=3 SV=2 | 113 | 422 | 1.0E-154 |
sp|Q4WP81|COX10_ASPFU | Protoheme IX farnesyltransferase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cox10 PE=3 SV=1 | 40 | 435 | 2.0E-126 |
sp|Q5BCK8|COX10_EMENI | Protoheme IX farnesyltransferase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cox10 PE=3 SV=1 | 63 | 423 | 2.0E-115 |
sp|Q6C0L2|COX10_YARLI | Protoheme IX farnesyltransferase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX10 PE=3 SV=1 | 108 | 427 | 2.0E-90 |
sp|Q6BKW6|COX10_DEBHA | Protoheme IX farnesyltransferase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=COX10 PE=3 SV=2 | 99 | 416 | 6.0E-86 |
sp|Q6CTW6|COX10_KLULA | Protoheme IX farnesyltransferase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=COX10 PE=3 SV=1 | 95 | 415 | 3.0E-84 |
sp|Q75F43|COX10_ASHGO | Protoheme IX farnesyltransferase, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COX10 PE=3 SV=1 | 103 | 415 | 7.0E-83 |
sp|Q6FUG4|COX10_CANGA | Protoheme IX farnesyltransferase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=COX10 PE=3 SV=1 | 99 | 415 | 2.0E-81 |
sp|P21592|COX10_YEAST | Protoheme IX farnesyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX10 PE=3 SV=1 | 101 | 415 | 3.0E-79 |
sp|Q9Y7Y4|COX10_SCHPO | Protoheme IX farnesyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox10 PE=3 SV=1 | 72 | 395 | 1.0E-72 |
sp|Q8CFY5|COX10_MOUSE | Protoheme IX farnesyltransferase, mitochondrial OS=Mus musculus GN=Cox10 PE=2 SV=1 | 107 | 395 | 6.0E-54 |
sp|Q12887|COX10_HUMAN | Protoheme IX farnesyltransferase, mitochondrial OS=Homo sapiens GN=COX10 PE=1 SV=3 | 107 | 395 | 4.0E-51 |
sp|Q5R460|COX10_PONAB | Protoheme IX farnesyltransferase, mitochondrial OS=Pongo abelii GN=COX10 PE=2 SV=1 | 107 | 395 | 3.0E-50 |
sp|O64886|COX10_ARATH | Protoheme IX farnesyltransferase, mitochondrial OS=Arabidopsis thaliana GN=COX10 PE=2 SV=4 | 109 | 410 | 2.0E-41 |
sp|Q01YC2|COXX_SOLUE | Protoheme IX farnesyltransferase OS=Solibacter usitatus (strain Ellin6076) GN=ctaB PE=3 SV=1 | 108 | 413 | 8.0E-36 |
sp|B1ZMT0|COXX_OPITP | Protoheme IX farnesyltransferase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ctaB PE=3 SV=1 | 104 | 403 | 4.0E-35 |
sp|A6H1E4|COXX_FLAPJ | Protoheme IX farnesyltransferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=ctaB PE=3 SV=1 | 91 | 410 | 1.0E-29 |
sp|Q8DHQ2|COXX_THEEB | Protoheme IX farnesyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=ctaB PE=3 SV=2 | 104 | 399 | 4.0E-29 |
sp|Q1D1K4|COXX_MYXXD | Protoheme IX farnesyltransferase OS=Myxococcus xanthus (strain DK 1622) GN=ctaB PE=3 SV=1 | 98 | 348 | 6.0E-29 |
sp|Q11SZ7|COXX_CYTH3 | Protoheme IX farnesyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=ctaB PE=3 SV=2 | 151 | 410 | 5.0E-28 |
sp|A0LXT1|COXX_GRAFK | Protoheme IX farnesyltransferase OS=Gramella forsetii (strain KT0803) GN=ctaB PE=3 SV=1 | 103 | 418 | 2.0E-27 |
sp|A5FJD0|COXX_FLAJ1 | Protoheme IX farnesyltransferase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=ctaB PE=3 SV=2 | 93 | 410 | 2.0E-27 |
sp|Q114N4|COXX_TRIEI | Protoheme IX farnesyltransferase OS=Trichodesmium erythraeum (strain IMS101) GN=ctaB PE=3 SV=1 | 98 | 408 | 3.0E-27 |
sp|Q2IPE5|COXX_ANADE | Protoheme IX farnesyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=ctaB PE=3 SV=2 | 104 | 410 | 3.0E-27 |
sp|Q7UJF4|COXX_RHOBA | Protoheme IX farnesyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ctaB PE=3 SV=2 | 107 | 329 | 4.0E-27 |
sp|A7H8V9|COXX_ANADF | Protoheme IX farnesyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=ctaB PE=3 SV=1 | 88 | 411 | 6.0E-27 |
sp|A1SY55|CYOE_PSYIN | Protoheme IX farnesyltransferase OS=Psychromonas ingrahamii (strain 37) GN=cyoE PE=3 SV=1 | 82 | 404 | 2.0E-26 |
sp|Q0VN94|CYOE_ALCBS | Protoheme IX farnesyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=cyoE PE=3 SV=1 | 108 | 376 | 3.0E-26 |
sp|Q54JB3|COX10_DICDI | Probable protoheme IX farnesyltransferase, mitochondrial OS=Dictyostelium discoideum GN=cox10 PE=3 SV=1 | 108 | 346 | 2.0E-25 |
sp|B1Y6Q4|COXX_LEPCP | Protoheme IX farnesyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ctaB PE=3 SV=1 | 108 | 399 | 2.0E-25 |
sp|A9GEU3|COXX_SORC5 | Protoheme IX farnesyltransferase OS=Sorangium cellulosum (strain So ce56) GN=ctaB PE=3 SV=2 | 139 | 324 | 4.0E-25 |
sp|B0TNS4|CYOE_SHEHH | Protoheme IX farnesyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=cyoE PE=3 SV=1 | 109 | 414 | 2.0E-24 |
sp|B9KLZ5|COXX_RHOSK | Protoheme IX farnesyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ctaB PE=3 SV=1 | 104 | 399 | 2.0E-24 |
sp|B0T0X6|COXX_CAUSK | Protoheme IX farnesyltransferase OS=Caulobacter sp. (strain K31) GN=ctaB PE=3 SV=1 | 108 | 380 | 3.0E-24 |
sp|Q2S012|COXX_SALRD | Protoheme IX farnesyltransferase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=ctaB PE=3 SV=2 | 103 | 408 | 5.0E-24 |
sp|A1RE84|CYOE2_SHESW | Protoheme IX farnesyltransferase 2 OS=Shewanella sp. (strain W3-18-1) GN=cyoE2 PE=3 SV=1 | 108 | 415 | 6.0E-24 |
sp|Q3J5F9|COXX_RHOS4 | Protoheme IX farnesyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ctaB PE=1 SV=1 | 104 | 399 | 7.0E-24 |
sp|A3PGX5|COXX_RHOS1 | Protoheme IX farnesyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ctaB PE=3 SV=1 | 104 | 399 | 7.0E-24 |
sp|Q21XT4|COXX_RHOFT | Protoheme IX farnesyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ctaB PE=3 SV=1 | 103 | 380 | 1.0E-23 |
sp|Q3IJQ0|CYOE2_PSEHT | Protoheme IX farnesyltransferase 2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cyoE2 PE=3 SV=1 | 93 | 410 | 1.0E-23 |
sp|Q21PS1|CYOE_SACD2 | Protoheme IX farnesyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cyoE PE=3 SV=1 | 108 | 408 | 1.0E-23 |
sp|B0C0A5|COXX_ACAM1 | Protoheme IX farnesyltransferase OS=Acaryochloris marina (strain MBIC 11017) GN=ctaB PE=3 SV=1 | 106 | 328 | 3.0E-23 |
sp|B8HMH3|COXX_CYAP4 | Protoheme IX farnesyltransferase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ctaB PE=3 SV=1 | 93 | 324 | 3.0E-23 |
sp|A0QWY2|COXX_MYCS2 | Protoheme IX farnesyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ctaB PE=3 SV=1 | 97 | 390 | 4.0E-23 |
sp|A4YC13|CYOE1_SHEPC | Protoheme IX farnesyltransferase 1 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cyoE1 PE=3 SV=1 | 108 | 415 | 1.0E-22 |
sp|Q79EF2|COXX_SYNY3 | Protoheme IX farnesyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ctaB PE=3 SV=1 | 162 | 399 | 1.0E-22 |
sp|A8H9S9|CYOE_SHEPA | Protoheme IX farnesyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cyoE PE=3 SV=1 | 109 | 414 | 2.0E-22 |
sp|A6WU15|CYOE1_SHEB8 | Protoheme IX farnesyltransferase 1 OS=Shewanella baltica (strain OS185) GN=cyoE1 PE=3 SV=1 | 108 | 398 | 3.0E-22 |
sp|Q089F2|CYOE2_SHEFN | Protoheme IX farnesyltransferase 2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=cyoE2 PE=3 SV=1 | 92 | 417 | 3.0E-22 |
sp|Q28MJ1|COXX_JANSC | Protoheme IX farnesyltransferase OS=Jannaschia sp. (strain CCS1) GN=ctaB PE=3 SV=1 | 91 | 390 | 3.0E-22 |
sp|Q0HDK5|CYOE1_SHESM | Protoheme IX farnesyltransferase 1 OS=Shewanella sp. (strain MR-4) GN=cyoE1 PE=3 SV=1 | 108 | 398 | 3.0E-22 |
sp|Q8E8P7|CYOE_SHEON | Protoheme IX farnesyltransferase OS=Shewanella oneidensis (strain MR-1) GN=cyoE PE=3 SV=1 | 108 | 398 | 5.0E-22 |
sp|Q6LVR2|CYOE_PHOPR | Protoheme IX farnesyltransferase OS=Photobacterium profundum GN=cyoE PE=3 SV=2 | 108 | 407 | 7.0E-22 |
sp|Q48AB7|CYOE_COLP3 | Protoheme IX farnesyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cyoE PE=3 SV=2 | 109 | 369 | 1.0E-21 |
sp|Q1IPI1|COXX_KORVE | Protoheme IX farnesyltransferase OS=Koribacter versatilis (strain Ellin345) GN=ctaB PE=3 SV=1 | 94 | 348 | 1.0E-21 |
sp|A3CYW8|CYOE_SHEB5 | Protoheme IX farnesyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cyoE PE=3 SV=1 | 108 | 398 | 2.0E-21 |
sp|A9KUX8|CYOE1_SHEB9 | Protoheme IX farnesyltransferase 1 OS=Shewanella baltica (strain OS195) GN=cyoE1 PE=3 SV=1 | 108 | 398 | 2.0E-21 |
sp|A0L2E7|CYOE1_SHESA | Protoheme IX farnesyltransferase 1 OS=Shewanella sp. (strain ANA-3) GN=cyoE1 PE=3 SV=1 | 108 | 398 | 2.0E-21 |
sp|C5BKU5|CYOE_TERTT | Protoheme IX farnesyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cyoE PE=3 SV=1 | 109 | 365 | 3.0E-21 |
sp|Q2YCM2|COXX_NITMU | Protoheme IX farnesyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ctaB PE=3 SV=1 | 110 | 399 | 3.0E-21 |
sp|A1VKM6|COXX_POLNA | Protoheme IX farnesyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=ctaB PE=3 SV=1 | 92 | 398 | 3.0E-21 |
sp|A1WBL5|COXX_ACISJ | Protoheme IX farnesyltransferase OS=Acidovorax sp. (strain JS42) GN=ctaB PE=3 SV=1 | 104 | 399 | 4.0E-21 |
sp|B9MF14|COXX_ACIET | Protoheme IX farnesyltransferase OS=Acidovorax ebreus (strain TPSY) GN=ctaB PE=3 SV=1 | 104 | 399 | 4.0E-21 |
sp|Q0HPV6|CYOE1_SHESR | Protoheme IX farnesyltransferase 1 OS=Shewanella sp. (strain MR-7) GN=cyoE1 PE=3 SV=1 | 108 | 398 | 4.0E-21 |
sp|A2SKN7|COXX_METPP | Protoheme IX farnesyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=ctaB PE=3 SV=1 | 94 | 398 | 5.0E-21 |
sp|Q87IR2|CYOE1_VIBPA | Protoheme IX farnesyltransferase 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cyoE1 PE=3 SV=1 | 99 | 398 | 5.0E-21 |
sp|A6T2T7|COXX_JANMA | Protoheme IX farnesyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=ctaB PE=3 SV=1 | 109 | 399 | 6.0E-21 |
sp|Q7NIL7|COXX_GLOVI | Protoheme IX farnesyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=ctaB PE=3 SV=1 | 94 | 399 | 6.0E-21 |
sp|A1WHP5|COXX_VEREI | Protoheme IX farnesyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=ctaB PE=3 SV=1 | 104 | 398 | 7.0E-21 |
sp|A1TWQ8|CYOE_MARHV | Protoheme IX farnesyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=cyoE PE=3 SV=2 | 108 | 380 | 8.0E-21 |
sp|Q12IC7|CYOE_SHEDO | Protoheme IX farnesyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=cyoE PE=3 SV=1 | 96 | 398 | 9.0E-21 |
sp|Q146A1|COXX_BURXL | Protoheme IX farnesyltransferase OS=Burkholderia xenovorans (strain LB400) GN=ctaB PE=3 SV=1 | 104 | 353 | 1.0E-20 |
sp|B7K336|COXX_CYAP8 | Protoheme IX farnesyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=ctaB PE=3 SV=1 | 102 | 399 | 1.0E-20 |
sp|Q9A301|COXX_CAUCR | Protoheme IX farnesyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ctaB PE=3 SV=1 | 108 | 348 | 1.0E-20 |
sp|Q12E37|COXX_POLSJ | Protoheme IX farnesyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ctaB PE=3 SV=1 | 91 | 408 | 1.0E-20 |
sp|Q5R0Y6|CYOE_IDILO | Protoheme IX farnesyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=cyoE PE=3 SV=1 | 108 | 408 | 2.0E-20 |
sp|A1KAQ4|COXX_AZOSB | Protoheme IX farnesyltransferase OS=Azoarcus sp. (strain BH72) GN=ctaB PE=3 SV=1 | 110 | 397 | 2.0E-20 |
sp|A7HQW1|COXX_PARL1 | Protoheme IX farnesyltransferase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=ctaB PE=3 SV=1 | 106 | 410 | 2.0E-20 |
sp|B6EQE1|CYOE_ALISL | Protoheme IX farnesyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=cyoE PE=3 SV=1 | 103 | 360 | 2.0E-20 |
sp|Q2JQK9|COXX_SYNJA | Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain JA-3-3Ab) GN=ctaB PE=3 SV=1 | 98 | 324 | 2.0E-20 |
sp|Q2JNL3|COXX_SYNJB | Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ctaB PE=3 SV=1 | 98 | 348 | 3.0E-20 |
sp|A7N6I9|CYOE2_VIBCB | Protoheme IX farnesyltransferase 2 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cyoE2 PE=3 SV=1 | 101 | 398 | 3.0E-20 |
sp|Q3MFT6|COXX_ANAVT | Protoheme IX farnesyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ctaB PE=3 SV=1 | 98 | 324 | 3.0E-20 |
sp|Q04444|COXX_BACPE | Protoheme IX farnesyltransferase OS=Bacillus pseudofirmus (strain OF4) GN=ctaB PE=3 SV=1 | 150 | 356 | 4.0E-20 |
sp|Q8YYA3|COXX_NOSS1 | Protoheme IX farnesyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ctaB PE=3 SV=1 | 98 | 324 | 5.0E-20 |
sp|B4EA84|COXX_BURCJ | Protoheme IX farnesyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ctaB PE=3 SV=1 | 104 | 348 | 6.0E-20 |
sp|A0KAR0|COXX_BURCH | Protoheme IX farnesyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=ctaB PE=3 SV=1 | 104 | 348 | 6.0E-20 |
sp|B1JZ41|COXX_BURCC | Protoheme IX farnesyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=ctaB PE=3 SV=1 | 104 | 348 | 6.0E-20 |
sp|Q1BTD0|COXX_BURCA | Protoheme IX farnesyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=ctaB PE=3 SV=1 | 104 | 348 | 6.0E-20 |
sp|Q7MDC8|CYOE_VIBVY | Protoheme IX farnesyltransferase OS=Vibrio vulnificus (strain YJ016) GN=cyoE PE=3 SV=1 | 99 | 397 | 6.0E-20 |
sp|Q0BBM3|COXX_BURCM | Protoheme IX farnesyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ctaB PE=3 SV=1 | 104 | 353 | 6.0E-20 |
sp|B1YN86|COXX_BURA4 | Protoheme IX farnesyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=ctaB PE=3 SV=1 | 104 | 353 | 8.0E-20 |
sp|B8GPF3|CYOE_THISH | Protoheme IX farnesyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=cyoE PE=3 SV=1 | 109 | 380 | 8.0E-20 |
sp|Q8D6H2|CYOE_VIBVU | Protoheme IX farnesyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=cyoE PE=3 SV=1 | 99 | 397 | 9.0E-20 |
sp|Q6G4C6|COXX_BARHE | Protoheme IX farnesyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ctaB PE=3 SV=1 | 86 | 409 | 9.0E-20 |
sp|Q1J1C3|COXX_DEIGD | Protoheme IX farnesyltransferase OS=Deinococcus geothermalis (strain DSM 11300) GN=ctaB PE=3 SV=2 | 91 | 381 | 9.0E-20 |
sp|B1XKB3|COXX_SYNP2 | Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ctaB PE=3 SV=1 | 103 | 399 | 1.0E-19 |
sp|Q1B9B1|COXX_MYCSS | Protoheme IX farnesyltransferase OS=Mycobacterium sp. (strain MCS) GN=ctaB PE=3 SV=2 | 97 | 390 | 1.0E-19 |
sp|A1UFQ0|COXX_MYCSK | Protoheme IX farnesyltransferase OS=Mycobacterium sp. (strain KMS) GN=ctaB PE=3 SV=2 | 97 | 390 | 1.0E-19 |
sp|A3PZB2|COXX_MYCSJ | Protoheme IX farnesyltransferase OS=Mycobacterium sp. (strain JLS) GN=ctaB PE=3 SV=1 | 97 | 390 | 1.0E-19 |
sp|A4G936|COXX_HERAR | Protoheme IX farnesyltransferase OS=Herminiimonas arsenicoxydans GN=ctaB PE=3 SV=1 | 109 | 399 | 1.0E-19 |
sp|Q39CQ5|COXX_BURL3 | Protoheme IX farnesyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ctaB PE=3 SV=1 | 104 | 348 | 1.0E-19 |
sp|Q2SQU8|CYOE_HAHCH | Protoheme IX farnesyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=cyoE PE=3 SV=1 | 109 | 380 | 1.0E-19 |
sp|Q3J6R6|CYOE_NITOC | Protoheme IX farnesyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=cyoE PE=3 SV=1 | 108 | 328 | 1.0E-19 |
sp|Q0ADH9|COXX_NITEC | Protoheme IX farnesyltransferase OS=Nitrosomonas eutropha (strain C91) GN=ctaB PE=3 SV=1 | 104 | 408 | 1.0E-19 |
sp|A4JI25|COXX_BURVG | Protoheme IX farnesyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ctaB PE=3 SV=1 | 104 | 348 | 2.0E-19 |
sp|Q5X7X6|CYOE_LEGPA | Protoheme IX farnesyltransferase OS=Legionella pneumophila (strain Paris) GN=cyoE PE=3 SV=1 | 108 | 335 | 2.0E-19 |
sp|Q829U3|COXX_STRAW | Protoheme IX farnesyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ctaB PE=3 SV=2 | 104 | 389 | 2.0E-19 |
sp|A4WQ57|COXX_RHOS5 | Protoheme IX farnesyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ctaB PE=3 SV=1 | 104 | 399 | 2.0E-19 |
sp|Q5P2E3|COXX_AROAE | Protoheme IX farnesyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=ctaB PE=3 SV=1 | 102 | 380 | 2.0E-19 |
sp|Q2T1F6|COXX_BURTA | Protoheme IX farnesyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ctaB PE=3 SV=1 | 104 | 337 | 2.0E-19 |
sp|A1TU04|COXX_ACIAC | Protoheme IX farnesyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=ctaB PE=3 SV=1 | 88 | 399 | 2.0E-19 |
sp|Q2KTX0|COXX_BORA1 | Protoheme IX farnesyltransferase OS=Bordetella avium (strain 197N) GN=ctaB PE=3 SV=1 | 103 | 399 | 2.0E-19 |
sp|Q63XS7|COXX_BURPS | Protoheme IX farnesyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=ctaB PE=3 SV=1 | 104 | 337 | 2.0E-19 |
sp|A3N5D1|COXX_BURP6 | Protoheme IX farnesyltransferase OS=Burkholderia pseudomallei (strain 668) GN=ctaB PE=3 SV=1 | 104 | 337 | 2.0E-19 |
sp|Q3JWF7|COXX_BURP1 | Protoheme IX farnesyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=ctaB PE=3 SV=1 | 104 | 337 | 2.0E-19 |
sp|A3NR29|COXX_BURP0 | Protoheme IX farnesyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=ctaB PE=3 SV=1 | 104 | 337 | 2.0E-19 |
sp|A1UZV8|COXX_BURMS | Protoheme IX farnesyltransferase OS=Burkholderia mallei (strain SAVP1) GN=ctaB PE=3 SV=1 | 104 | 337 | 2.0E-19 |
sp|Q62F61|COXX_BURMA | Protoheme IX farnesyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=ctaB PE=3 SV=1 | 104 | 337 | 2.0E-19 |
sp|A2S646|COXX_BURM9 | Protoheme IX farnesyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=ctaB PE=3 SV=1 | 104 | 337 | 2.0E-19 |
sp|A3MQ44|COXX_BURM7 | Protoheme IX farnesyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=ctaB PE=3 SV=1 | 104 | 337 | 2.0E-19 |
sp|Q5V5S6|COXX_HALMA | Protoheme IX farnesyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ctaB PE=3 SV=1 | 145 | 404 | 2.0E-19 |
sp|Q0C3D1|COXX_HYPNA | Protoheme IX farnesyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=ctaB PE=3 SV=1 | 105 | 382 | 3.0E-19 |
sp|Q5WZC7|CYOE_LEGPL | Protoheme IX farnesyltransferase OS=Legionella pneumophila (strain Lens) GN=cyoE PE=3 SV=1 | 108 | 337 | 3.0E-19 |
sp|P56938|COXX_RHOSH | Protoheme IX farnesyltransferase OS=Rhodobacter sphaeroides GN=ctaB PE=3 SV=1 | 118 | 382 | 3.0E-19 |
sp|Q5ZYG0|CYOE_LEGPH | Protoheme IX farnesyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=cyoE PE=3 SV=1 | 108 | 337 | 3.0E-19 |
sp|A5IHI2|CYOE_LEGPC | Protoheme IX farnesyltransferase OS=Legionella pneumophila (strain Corby) GN=cyoE PE=3 SV=1 | 108 | 337 | 3.0E-19 |
sp|B2VHR9|CYOE_ERWT9 | Protoheme IX farnesyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cyoE PE=3 SV=1 | 152 | 405 | 3.0E-19 |
sp|Q72H22|COXX_THET2 | Protoheme IX farnesyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ctaB PE=3 SV=1 | 108 | 324 | 4.0E-19 |
sp|Q5SLI3|COXX_THET8 | Protoheme IX farnesyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ctaB PE=3 SV=1 | 108 | 324 | 4.0E-19 |
sp|A3Q941|CYOE1_SHELP | Protoheme IX farnesyltransferase 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=cyoE1 PE=3 SV=1 | 108 | 398 | 4.0E-19 |
sp|Q5HAA6|COXX_EHRRW | Protoheme IX farnesyltransferase OS=Ehrlichia ruminantium (strain Welgevonden) GN=ctaB PE=3 SV=1 | 110 | 399 | 4.0E-19 |
sp|Q5FGC3|COXX_EHRRG | Protoheme IX farnesyltransferase OS=Ehrlichia ruminantium (strain Gardel) GN=ctaB PE=3 SV=1 | 110 | 399 | 4.0E-19 |
sp|A4VS42|CYOE_PSEU5 | Protoheme IX farnesyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=cyoE PE=3 SV=1 | 108 | 350 | 4.0E-19 |
sp|A9HWL4|COXX_BORPD | Protoheme IX farnesyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=ctaB PE=3 SV=1 | 103 | 344 | 6.0E-19 |
sp|Q2GJ17|COXX_ANAPZ | Protoheme IX farnesyltransferase OS=Anaplasma phagocytophilum (strain HZ) GN=ctaB PE=3 SV=1 | 109 | 399 | 7.0E-19 |
sp|Q3SUL3|COXX2_NITWN | Protoheme IX farnesyltransferase 2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ctaB2 PE=3 SV=2 | 86 | 389 | 8.0E-19 |
sp|Q3SW48|COXX1_NITWN | Protoheme IX farnesyltransferase 1 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ctaB1 PE=3 SV=1 | 86 | 389 | 8.0E-19 |
sp|Q1QHV7|COXX_NITHX | Protoheme IX farnesyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ctaB1 PE=3 SV=2 | 92 | 389 | 9.0E-19 |
sp|Q5LNX8|COXX_RUEPO | Protoheme IX farnesyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ctaB PE=3 SV=1 | 78 | 413 | 9.0E-19 |
sp|Q3YR13|COXX_EHRCJ | Protoheme IX farnesyltransferase OS=Ehrlichia canis (strain Jake) GN=ctaB PE=3 SV=1 | 109 | 408 | 9.0E-19 |
sp|Q8FT77|COXX_COREF | Protoheme IX farnesyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ctaB PE=3 SV=2 | 104 | 351 | 1.0E-18 |
sp|Q82VQ6|COXX_NITEU | Protoheme IX farnesyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ctaB PE=3 SV=1 | 110 | 379 | 1.0E-18 |
sp|Q0RH20|COXX_FRAAA | Protoheme IX farnesyltransferase OS=Frankia alni (strain ACN14a) GN=ctaB PE=3 SV=2 | 154 | 399 | 1.0E-18 |
sp|Q74GM3|COXX_GEOSL | Protoheme IX farnesyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ctaB PE=3 SV=1 | 108 | 321 | 1.0E-18 |
sp|Q4FPD2|COXX_PELUB | Protoheme IX farnesyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=ctaB PE=3 SV=2 | 104 | 410 | 1.0E-18 |
sp|B1W108|COXX_STRGG | Protoheme IX farnesyltransferase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=ctaB PE=3 SV=2 | 84 | 365 | 1.0E-18 |
sp|B4SHI1|CYOE_STRM5 | Protoheme IX farnesyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=cyoE PE=3 SV=1 | 109 | 356 | 2.0E-18 |
sp|Q3KK91|CYOE1_PSEPF | Protoheme IX farnesyltransferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=cyoE1 PE=3 SV=2 | 95 | 404 | 2.0E-18 |
sp|A4T079|COXX_POLSQ | Protoheme IX farnesyltransferase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ctaB PE=3 SV=1 | 110 | 369 | 3.0E-18 |
sp|Q13CY5|COXX_RHOPS | Protoheme IX farnesyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=ctaB PE=3 SV=1 | 97 | 415 | 3.0E-18 |
sp|Q07HB2|COXX_RHOP5 | Protoheme IX farnesyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=ctaB PE=3 SV=1 | 97 | 398 | 3.0E-18 |
sp|A1BA40|COXX_PARDP | Protoheme IX farnesyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=ctaB PE=3 SV=1 | 104 | 354 | 4.0E-18 |
sp|B1KM58|CYOE1_SHEWM | Protoheme IX farnesyltransferase 1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cyoE1 PE=3 SV=1 | 109 | 414 | 7.0E-18 |
sp|Q2IR91|COXX_RHOP2 | Protoheme IX farnesyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=ctaB PE=3 SV=1 | 97 | 414 | 8.0E-18 |
sp|Q741B3|COXX_MYCPA | Protoheme IX farnesyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ctaB PE=3 SV=1 | 92 | 390 | 1.0E-17 |
sp|C5BFX0|CYOE_EDWI9 | Protoheme IX farnesyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=cyoE PE=3 SV=1 | 152 | 396 | 1.0E-17 |
sp|B7KHX2|COXX_CYAP7 | Protoheme IX farnesyltransferase OS=Cyanothece sp. (strain PCC 7424) GN=ctaB PE=3 SV=1 | 102 | 324 | 1.0E-17 |
sp|B1MC66|COXX_MYCA9 | Protoheme IX farnesyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=ctaB PE=3 SV=1 | 97 | 390 | 1.0E-17 |
sp|Q2GFJ2|COXX_EHRCR | Protoheme IX farnesyltransferase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=ctaB PE=3 SV=1 | 109 | 348 | 1.0E-17 |
sp|Q9XAC2|COXX_STRCO | Protoheme IX farnesyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ctaB PE=3 SV=2 | 104 | 365 | 1.0E-17 |
sp|Q4KKL2|CYOE1_PSEF5 | Protoheme IX farnesyltransferase 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cyoE1 PE=3 SV=1 | 95 | 365 | 1.0E-17 |
sp|A9IQQ6|COXX_BART1 | Protoheme IX farnesyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ctaB PE=3 SV=1 | 94 | 403 | 1.0E-17 |
sp|Q65K13|COXX_BACLD | Protoheme IX farnesyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ctaB PE=3 SV=1 | 151 | 324 | 1.0E-17 |
sp|Q39Z26|COXX_GEOMG | Protoheme IX farnesyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=ctaB PE=3 SV=1 | 156 | 325 | 1.0E-17 |
sp|A0QHX0|COXX_MYCA1 | Protoheme IX farnesyltransferase OS=Mycobacterium avium (strain 104) GN=ctaB PE=3 SV=2 | 92 | 324 | 1.0E-17 |
sp|Q7U550|COXX_SYNPX | Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain WH8102) GN=ctaB PE=3 SV=1 | 108 | 415 | 2.0E-17 |
sp|Q7W316|COXX_BORPA | Protoheme IX farnesyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ctaB PE=3 SV=1 | 103 | 348 | 2.0E-17 |
sp|Q7WE16|COXX_BORBR | Protoheme IX farnesyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ctaB PE=3 SV=1 | 103 | 348 | 2.0E-17 |
sp|A8LHT6|COXX_DINSH | Protoheme IX farnesyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ctaB PE=3 SV=2 | 97 | 424 | 2.0E-17 |
sp|Q9PDL9|CYOE_XYLFA | Protoheme IX farnesyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=cyoE PE=3 SV=2 | 109 | 379 | 2.0E-17 |
sp|Q7VT22|COXX_BORPE | Protoheme IX farnesyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ctaB PE=3 SV=1 | 103 | 348 | 3.0E-17 |
sp|P67054|COXX_BRUSU | Protoheme IX farnesyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=ctaB PE=3 SV=2 | 108 | 409 | 3.0E-17 |
sp|A5VP40|COXX_BRUO2 | Protoheme IX farnesyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ctaB PE=3 SV=1 | 108 | 409 | 3.0E-17 |
sp|P67053|COXX_BRUME | Protoheme IX farnesyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ctaB PE=3 SV=2 | 108 | 409 | 3.0E-17 |
sp|Q8NQ66|COXX_CORGL | Protoheme IX farnesyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ctaB PE=3 SV=1 | 104 | 361 | 3.0E-17 |
sp|A4QEE9|COXX_CORGB | Protoheme IX farnesyltransferase OS=Corynebacterium glutamicum (strain R) GN=ctaB PE=3 SV=1 | 104 | 361 | 3.0E-17 |
sp|C0RHH6|COXX_BRUMB | Protoheme IX farnesyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ctaB PE=3 SV=1 | 108 | 409 | 3.0E-17 |
sp|A9M8Z3|COXX_BRUC2 | Protoheme IX farnesyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ctaB PE=3 SV=1 | 108 | 409 | 3.0E-17 |
sp|B0CKF4|COXX_BRUSI | Protoheme IX farnesyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ctaB PE=3 SV=1 | 108 | 409 | 4.0E-17 |
sp|A7MFG8|CYOE_CROS8 | Protoheme IX farnesyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cyoE PE=3 SV=1 | 151 | 396 | 4.0E-17 |
sp|A5GMY0|COXX_SYNPW | Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain WH7803) GN=ctaB PE=3 SV=1 | 97 | 411 | 4.0E-17 |
sp|Q5YTS1|COXX_NOCFA | Protoheme IX farnesyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=ctaB PE=3 SV=1 | 96 | 390 | 4.0E-17 |
sp|Q2JCG7|COXX_FRASC | Protoheme IX farnesyltransferase OS=Frankia sp. (strain CcI3) GN=ctaB PE=3 SV=1 | 143 | 399 | 4.0E-17 |
sp|P08301|COXX_PARDE | Protoheme IX farnesyltransferase OS=Paracoccus denitrificans GN=ctaB PE=3 SV=2 | 104 | 354 | 5.0E-17 |
sp|Q3SLW5|COXX_THIDA | Protoheme IX farnesyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=ctaB PE=3 SV=1 | 105 | 328 | 5.0E-17 |
sp|A8IDL3|COXX_AZOC5 | Protoheme IX farnesyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=ctaB PE=3 SV=2 | 108 | 396 | 5.0E-17 |
sp|O31652|COXX1_BACSU | Protoheme IX farnesyltransferase 1 OS=Bacillus subtilis (strain 168) GN=ctaB1 PE=1 SV=3 | 157 | 348 | 5.0E-17 |
sp|A9MM32|CYOE_SALAR | Protoheme IX farnesyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cyoE PE=3 SV=1 | 151 | 405 | 5.0E-17 |
sp|A9MWZ0|CYOE_SALPB | Protoheme IX farnesyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cyoE PE=3 SV=1 | 151 | 405 | 6.0E-17 |
sp|A8AK26|CYOE_CITK8 | Protoheme IX farnesyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cyoE PE=3 SV=1 | 151 | 405 | 6.0E-17 |
sp|Q5N1X0|COXX_SYNP6 | Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ctaB PE=3 SV=1 | 109 | 324 | 6.0E-17 |
sp|Q31JY9|COXX_SYNE7 | Protoheme IX farnesyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=ctaB PE=3 SV=2 | 109 | 324 | 6.0E-17 |
sp|Q8ZRC4|CYOE_SALTY | Protoheme IX farnesyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cyoE PE=3 SV=1 | 151 | 405 | 6.0E-17 |
sp|Q5PFP5|CYOE_SALPA | Protoheme IX farnesyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cyoE PE=3 SV=1 | 151 | 405 | 6.0E-17 |
sp|Q57SC4|CYOE_SALCH | Protoheme IX farnesyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=cyoE PE=3 SV=2 | 151 | 405 | 6.0E-17 |
sp|Q1GE49|COXX_RUEST | Protoheme IX farnesyltransferase OS=Ruegeria sp. (strain TM1040) GN=ctaB PE=3 SV=1 | 104 | 382 | 6.0E-17 |
sp|Q8Z8V5|CYOE_SALTI | Protoheme IX farnesyltransferase OS=Salmonella typhi GN=cyoE PE=3 SV=1 | 151 | 405 | 7.0E-17 |
sp|A1R6I0|COXX_ARTAT | Protoheme IX farnesyltransferase OS=Arthrobacter aurescens (strain TC1) GN=ctaB PE=3 SV=1 | 76 | 404 | 9.0E-17 |
sp|A0PPP7|COXX_MYCUA | Protoheme IX farnesyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=ctaB PE=3 SV=1 | 108 | 390 | 9.0E-17 |
sp|B2AGR8|COXX_CUPTR | Protoheme IX farnesyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ctaB PE=3 SV=2 | 100 | 360 | 1.0E-16 |
sp|A4FBP2|COXX2_SACEN | Protoheme IX farnesyltransferase 2 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=ctaB2 PE=3 SV=1 | 82 | 390 | 1.0E-16 |
sp|Q87DT0|CYOE_XYLFT | Protoheme IX farnesyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cyoE PE=3 SV=2 | 109 | 379 | 1.0E-16 |
sp|Q0I891|COXX_SYNS3 | Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain CC9311) GN=ctaB PE=3 SV=1 | 108 | 410 | 1.0E-16 |
sp|Q9RM98|COXX_BRADU | Protoheme IX farnesyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ctaB PE=3 SV=1 | 86 | 402 | 1.0E-16 |
sp|Q476H8|COXX_CUPPJ | Protoheme IX farnesyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ctaB PE=3 SV=2 | 91 | 391 | 1.0E-16 |
sp|A6WWG0|COXX_OCHA4 | Protoheme IX farnesyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ctaB PE=3 SV=2 | 108 | 424 | 1.0E-16 |
sp|A4F9B0|COXX1_SACEN | Protoheme IX farnesyltransferase 1 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=ctaB1 PE=3 SV=2 | 95 | 392 | 1.0E-16 |
sp|A8LW09|COXX_SALAI | Protoheme IX farnesyltransferase OS=Salinispora arenicola (strain CNS-205) GN=ctaB PE=3 SV=1 | 98 | 324 | 1.0E-16 |
sp|A6T5H1|CYOE_KLEP7 | Protoheme IX farnesyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cyoE PE=3 SV=1 | 157 | 405 | 2.0E-16 |
sp|A8KYS6|COXX_FRASN | Protoheme IX farnesyltransferase OS=Frankia sp. (strain EAN1pec) GN=ctaB PE=3 SV=1 | 154 | 390 | 2.0E-16 |
sp|B8H7N5|COXX_ARTCA | Protoheme IX farnesyltransferase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=ctaB PE=3 SV=1 | 73 | 375 | 2.0E-16 |
sp|P9WFR7|COXX_MYCTU | Protoheme IX farnesyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctaB PE=3 SV=1 | 96 | 390 | 2.0E-16 |
sp|P9WFR6|COXX_MYCTO | Protoheme IX farnesyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctaB PE=3 SV=1 | 96 | 390 | 2.0E-16 |
sp|A1QRH1|COXX_MYCTF | Protoheme IX farnesyltransferase OS=Mycobacterium tuberculosis (strain F11) GN=ctaB1 PE=3 SV=1 | 96 | 390 | 2.0E-16 |
sp|A5U2F4|COXX_MYCTA | Protoheme IX farnesyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ctaB PE=3 SV=1 | 96 | 390 | 2.0E-16 |
sp|Q8PFU4|CYOE_XANAC | Protoheme IX farnesyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cyoE PE=3 SV=1 | 109 | 360 | 2.0E-16 |
sp|Q1H1S8|COXX_METFK | Protoheme IX farnesyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ctaB PE=3 SV=1 | 157 | 417 | 2.0E-16 |
sp|A4X9F8|COXX_SALTO | Protoheme IX farnesyltransferase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=ctaB PE=3 SV=2 | 81 | 324 | 2.0E-16 |
sp|Q167W1|COXX_ROSDO | Protoheme IX farnesyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ctaB PE=3 SV=1 | 104 | 354 | 2.0E-16 |
sp|Q0AMG9|COXX_MARMM | Protoheme IX farnesyltransferase OS=Maricaulis maris (strain MCS10) GN=ctaB PE=3 SV=1 | 108 | 389 | 2.0E-16 |
sp|Q325H3|CYOE_SHIBS | Protoheme IX farnesyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=cyoE PE=3 SV=1 | 151 | 405 | 2.0E-16 |
sp|B1LJI2|CYOE_ECOSM | Protoheme IX farnesyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cyoE PE=3 SV=1 | 151 | 405 | 2.0E-16 |
sp|P0AEA5|CYOE_ECOLI | Protoheme IX farnesyltransferase OS=Escherichia coli (strain K12) GN=cyoE PE=1 SV=1 | 151 | 405 | 2.0E-16 |
sp|B1J021|CYOE_ECOLC | Protoheme IX farnesyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cyoE PE=3 SV=1 | 151 | 405 | 2.0E-16 |
sp|P0AEA6|CYOE_ECOL6 | Protoheme IX farnesyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cyoE PE=3 SV=1 | 151 | 405 | 2.0E-16 |
sp|A7ZX84|CYOE_ECOHS | Protoheme IX farnesyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=cyoE PE=3 SV=1 | 151 | 405 | 2.0E-16 |
sp|B1XFL6|CYOE_ECODH | Protoheme IX farnesyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=cyoE PE=3 SV=1 | 151 | 405 | 2.0E-16 |
sp|P0AEA7|CYOE_ECO57 | Protoheme IX farnesyltransferase OS=Escherichia coli O157:H7 GN=cyoE PE=3 SV=1 | 151 | 405 | 2.0E-16 |
sp|A7ZII5|CYOE_ECO24 | Protoheme IX farnesyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cyoE PE=3 SV=1 | 151 | 405 | 2.0E-16 |
sp|Q1RFB2|CYOE_ECOUT | Protoheme IX farnesyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=cyoE PE=3 SV=2 | 151 | 405 | 2.0E-16 |
sp|Q0TKL4|CYOE_ECOL5 | Protoheme IX farnesyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cyoE PE=3 SV=1 | 151 | 405 | 2.0E-16 |
sp|A1A897|CYOE_ECOK1 | Protoheme IX farnesyltransferase OS=Escherichia coli O1:K1 / APEC GN=cyoE PE=3 SV=2 | 151 | 405 | 2.0E-16 |
sp|A0JWQ8|COXX_ARTS2 | Protoheme IX farnesyltransferase OS=Arthrobacter sp. (strain FB24) GN=ctaB PE=3 SV=1 | 76 | 404 | 2.0E-16 |
sp|Q3AV04|COXX_SYNS9 | Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain CC9902) GN=ctaB PE=3 SV=1 | 82 | 413 | 2.0E-16 |
sp|B1M595|COXX_METRJ | Protoheme IX farnesyltransferase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=ctaB PE=3 SV=1 | 108 | 399 | 2.0E-16 |
sp|A8GAQ0|CYOE_SERP5 | Protoheme IX farnesyltransferase OS=Serratia proteamaculans (strain 568) GN=cyoE PE=3 SV=1 | 152 | 396 | 3.0E-16 |
sp|Q87IH5|CYOE2_VIBPA | Protoheme IX farnesyltransferase 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cyoE2 PE=3 SV=1 | 103 | 370 | 3.0E-16 |
sp|C0R2X3|COXX_WOLWR | Protoheme IX farnesyltransferase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=ctaB PE=3 SV=1 | 110 | 339 | 3.0E-16 |
sp|Q9K9M9|COXX_BACHD | Protoheme IX farnesyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ctaB PE=3 SV=1 | 149 | 324 | 4.0E-16 |
sp|A4W799|CYOE_ENT38 | Protoheme IX farnesyltransferase OS=Enterobacter sp. (strain 638) GN=cyoE PE=3 SV=1 | 156 | 396 | 4.0E-16 |
sp|Q2NCF2|COXX_ERYLH | Protoheme IX farnesyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=ctaB PE=3 SV=1 | 106 | 365 | 4.0E-16 |
sp|Q20X25|COXX_RHOPB | Protoheme IX farnesyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=ctaB PE=3 SV=1 | 97 | 398 | 4.0E-16 |
sp|Q1LRS0|COXX_CUPMC | Protoheme IX farnesyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ctaB PE=3 SV=2 | 100 | 399 | 4.0E-16 |
sp|C1AN96|COXX_MYCBT | Protoheme IX farnesyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=ctaB PE=3 SV=1 | 96 | 390 | 4.0E-16 |
sp|A1KIP0|COXX_MYCBP | Protoheme IX farnesyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ctaB PE=3 SV=1 | 96 | 390 | 4.0E-16 |
sp|Q7U021|COXX_MYCBO | Protoheme IX farnesyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctaB PE=3 SV=1 | 96 | 390 | 4.0E-16 |
sp|B3CN58|COXX_WOLPP | Protoheme IX farnesyltransferase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=ctaB PE=3 SV=1 | 110 | 344 | 5.0E-16 |
sp|Q3BND5|CYOE_XANC5 | Protoheme IX farnesyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=cyoE PE=3 SV=1 | 109 | 356 | 5.0E-16 |
sp|Q73I75|COXX_WOLPM | Protoheme IX farnesyltransferase OS=Wolbachia pipientis wMel GN=ctaB PE=3 SV=1 | 110 | 323 | 5.0E-16 |
sp|Q6NBJ5|COXX_RHOPA | Protoheme IX farnesyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ctaB PE=3 SV=2 | 97 | 409 | 5.0E-16 |
sp|A1JNP6|CYOE_YERE8 | Protoheme IX farnesyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cyoE PE=3 SV=1 | 157 | 396 | 5.0E-16 |
sp|A6UXP9|CYOE1_PSEA7 | Protoheme IX farnesyltransferase 1 OS=Pseudomonas aeruginosa (strain PA7) GN=cyoE1 PE=3 SV=1 | 106 | 365 | 6.0E-16 |
sp|Q9I719|CYOE1_PSEAE | Protoheme IX farnesyltransferase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cyoE1 PE=3 SV=1 | 106 | 365 | 6.0E-16 |
sp|Q02UW5|CYOE1_PSEAB | Protoheme IX farnesyltransferase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cyoE1 PE=3 SV=1 | 106 | 365 | 6.0E-16 |
sp|Q18JU9|COXX_HALWD | Protoheme IX farnesyltransferase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ctaB PE=3 SV=1 | 94 | 404 | 6.0E-16 |
sp|Q9RR78|COXX_DEIRA | Protoheme IX farnesyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ctaB PE=3 SV=1 | 151 | 381 | 7.0E-16 |
sp|A8FCU6|COXX_BACP2 | Protoheme IX farnesyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=ctaB PE=3 SV=1 | 146 | 324 | 7.0E-16 |
sp|Q83GF8|COXX_TROWT | Protoheme IX farnesyltransferase OS=Tropheryma whipplei (strain Twist) GN=ctaB PE=3 SV=1 | 98 | 392 | 7.0E-16 |
sp|Q83NK0|COXX_TROW8 | Protoheme IX farnesyltransferase OS=Tropheryma whipplei (strain TW08/27) GN=ctaB PE=3 SV=1 | 98 | 392 | 7.0E-16 |
sp|Q48M92|CYOE_PSE14 | Protoheme IX farnesyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=cyoE PE=3 SV=1 | 152 | 405 | 7.0E-16 |
sp|Q3Z4X5|CYOE_SHISS | Protoheme IX farnesyltransferase OS=Shigella sonnei (strain Ss046) GN=cyoE PE=3 SV=1 | 151 | 405 | 7.0E-16 |
sp|A1T8M8|COXX_MYCVP | Protoheme IX farnesyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=ctaB PE=3 SV=1 | 88 | 390 | 7.0E-16 |
sp|A1AV76|CYOE_RUTMC | Protoheme IX farnesyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=cyoE PE=3 SV=1 | 103 | 328 | 8.0E-16 |
sp|B1XS75|COXX_POLNS | Protoheme IX farnesyltransferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=ctaB PE=3 SV=1 | 110 | 331 | 9.0E-16 |
sp|A4XNK8|CYOE_PSEMY | Protoheme IX farnesyltransferase OS=Pseudomonas mendocina (strain ymp) GN=cyoE PE=3 SV=1 | 108 | 365 | 1.0E-15 |
sp|Q47G19|COXX_DECAR | Protoheme IX farnesyltransferase OS=Dechloromonas aromatica (strain RCB) GN=ctaB PE=3 SV=1 | 94 | 350 | 1.0E-15 |
sp|Q5GSX9|COXX_WOLTR | Protoheme IX farnesyltransferase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=ctaB PE=3 SV=1 | 110 | 339 | 1.0E-15 |
sp|Q0KER8|COXX_CUPNH | Protoheme IX farnesyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ctaB PE=3 SV=1 | 100 | 360 | 1.0E-15 |
sp|Q5GV87|CYOE_XANOR | Protoheme IX farnesyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=cyoE PE=3 SV=2 | 109 | 353 | 2.0E-15 |
sp|Q2NYG1|CYOE_XANOM | Protoheme IX farnesyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=cyoE PE=3 SV=1 | 109 | 353 | 2.0E-15 |
sp|A9VUA6|COXX_BACWK | Protoheme IX farnesyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=ctaB PE=3 SV=1 | 151 | 404 | 2.0E-15 |
sp|A8FPN0|CYOE_SHESH | Protoheme IX farnesyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=cyoE PE=3 SV=1 | 109 | 398 | 2.0E-15 |
sp|Q2NV87|CYOE_SODGM | Protoheme IX farnesyltransferase OS=Sodalis glossinidius (strain morsitans) GN=cyoE PE=3 SV=2 | 157 | 396 | 2.0E-15 |
sp|Q8K997|CYOE_BUCAP | Protoheme IX farnesyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cyoE PE=3 SV=1 | 157 | 321 | 2.0E-15 |
sp|Q887G7|CYOE_PSESM | Protoheme IX farnesyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cyoE PE=3 SV=1 | 157 | 405 | 2.0E-15 |
sp|A4TC38|COXX_MYCGI | Protoheme IX farnesyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=ctaB PE=3 SV=1 | 93 | 390 | 2.0E-15 |
sp|Q88RL9|CYOE1_PSEPK | Protoheme IX farnesyltransferase 1 OS=Pseudomonas putida (strain KT2440) GN=cyoE1 PE=3 SV=1 | 108 | 369 | 2.0E-15 |
sp|A2C7D7|COXX_PROM3 | Protoheme IX farnesyltransferase OS=Prochlorococcus marinus (strain MIT 9303) GN=ctaB PE=3 SV=1 | 97 | 413 | 2.0E-15 |
sp|Q83SF7|CYOE_SHIFL | Protoheme IX farnesyltransferase OS=Shigella flexneri GN=cyoE PE=3 SV=5 | 151 | 405 | 3.0E-15 |
sp|B0JGA8|COXX_MICAN | Protoheme IX farnesyltransferase OS=Microcystis aeruginosa (strain NIES-843) GN=ctaB PE=3 SV=1 | 88 | 399 | 3.0E-15 |
sp|A7Z2K2|COXX1_BACMF | Protoheme IX farnesyltransferase 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ctaB1 PE=3 SV=1 | 157 | 407 | 3.0E-15 |
sp|A0LTZ0|COXX_ACIC1 | Protoheme IX farnesyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=ctaB PE=3 SV=1 | 103 | 375 | 3.0E-15 |
sp|Q3ALZ8|COXX_SYNSC | Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain CC9605) GN=ctaB PE=3 SV=1 | 97 | 415 | 3.0E-15 |
sp|B1J467|CYOE1_PSEPW | Protoheme IX farnesyltransferase 1 OS=Pseudomonas putida (strain W619) GN=cyoE1 PE=3 SV=1 | 108 | 404 | 3.0E-15 |
sp|A1URX1|COXX_BARBK | Protoheme IX farnesyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ctaB PE=3 SV=1 | 108 | 409 | 3.0E-15 |
sp|Q8P487|CYOE_XANCP | Protoheme IX farnesyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cyoE PE=3 SV=2 | 109 | 356 | 3.0E-15 |
sp|B0RXJ1|CYOE_XANCB | Protoheme IX farnesyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=cyoE PE=3 SV=2 | 109 | 356 | 3.0E-15 |
sp|Q4UPT7|CYOE_XANC8 | Protoheme IX farnesyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=cyoE PE=3 SV=2 | 109 | 356 | 3.0E-15 |
sp|Q985X0|COXX2_RHILO | Protoheme IX farnesyltransferase 2 OS=Rhizobium loti (strain MAFF303099) GN=ctaB2 PE=3 SV=1 | 106 | 391 | 4.0E-15 |
sp|Q8CXI8|COXX_OCEIH | Protoheme IX farnesyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ctaB PE=3 SV=1 | 150 | 324 | 4.0E-15 |
sp|A5CXZ0|CYOE_VESOH | Protoheme IX farnesyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=cyoE PE=3 SV=1 | 103 | 328 | 4.0E-15 |
sp|B6JDB7|COXX_OLICO | Protoheme IX farnesyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=ctaB PE=3 SV=1 | 104 | 390 | 5.0E-15 |
sp|Q7V638|COXX_PROMM | Protoheme IX farnesyltransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=ctaB PE=3 SV=1 | 97 | 413 | 5.0E-15 |
sp|Q310M2|COXX_DESAG | Protoheme IX farnesyltransferase OS=Desulfovibrio alaskensis (strain G20) GN=ctaB PE=3 SV=1 | 156 | 331 | 5.0E-15 |
sp|A7Z4B1|COXX2_BACMF | Protoheme IX farnesyltransferase 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ctaB2 PE=3 SV=1 | 150 | 324 | 5.0E-15 |
sp|O66544|COXX_AQUAE | Protoheme IX farnesyltransferase OS=Aquifex aeolicus (strain VF5) GN=ctaB PE=3 SV=1 | 101 | 399 | 6.0E-15 |
sp|C6DB46|CYOE_PECCP | Protoheme IX farnesyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cyoE PE=3 SV=1 | 152 | 370 | 7.0E-15 |
sp|Q6G0D0|COXX_BARQU | Protoheme IX farnesyltransferase OS=Bartonella quintana (strain Toulouse) GN=ctaB PE=3 SV=1 | 96 | 409 | 7.0E-15 |
sp|P24009|COXX2_BACSU | Protoheme IX farnesyltransferase 2 OS=Bacillus subtilis (strain 168) GN=ctaB2 PE=1 SV=2 | 150 | 324 | 8.0E-15 |
sp|A1SJR1|COXX_NOCSJ | Protoheme IX farnesyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=ctaB PE=3 SV=1 | 99 | 379 | 9.0E-15 |
sp|A5VWP2|CYOE1_PSEP1 | Protoheme IX farnesyltransferase 1 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cyoE1 PE=3 SV=1 | 108 | 348 | 9.0E-15 |
sp|C1DG34|CYOE_AZOVD | Protoheme IX farnesyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=cyoE PE=3 SV=1 | 108 | 328 | 9.0E-15 |
sp|Q4ZXC3|CYOE_PSEU2 | Protoheme IX farnesyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=cyoE PE=3 SV=1 | 152 | 405 | 1.0E-14 |
sp|Q6D836|CYOE_PECAS | Protoheme IX farnesyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cyoE PE=3 SV=1 | 152 | 370 | 1.0E-14 |
sp|A5EA98|COXX_BRASB | Protoheme IX farnesyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ctaB PE=3 SV=1 | 86 | 403 | 1.0E-14 |
sp|Q2GDE4|COXX_NEOSM | Protoheme IX farnesyltransferase OS=Neorickettsia sennetsu (strain Miyayama) GN=ctaB PE=3 SV=1 | 108 | 399 | 1.0E-14 |
sp|B1YIW5|COXX_EXIS2 | Protoheme IX farnesyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=ctaB PE=3 SV=1 | 157 | 328 | 1.0E-14 |
sp|A9WT38|COXX_RENSM | Protoheme IX farnesyltransferase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=ctaB PE=3 SV=1 | 169 | 389 | 1.0E-14 |
sp|C4K2Q8|COXX_RICPU | Protoheme IX farnesyltransferase OS=Rickettsia peacockii (strain Rustic) GN=ctaB PE=3 SV=1 | 110 | 364 | 1.0E-14 |
sp|Q4K6M1|CYOE2_PSEF5 | Protoheme IX farnesyltransferase 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=cyoE2 PE=3 SV=1 | 152 | 405 | 1.0E-14 |
sp|Q9I423|CYOE2_PSEAE | Protoheme IX farnesyltransferase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cyoE2 PE=3 SV=1 | 145 | 370 | 2.0E-14 |
sp|Q02JG2|CYOE2_PSEAB | Protoheme IX farnesyltransferase 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cyoE2 PE=3 SV=1 | 145 | 370 | 2.0E-14 |
sp|B0KFZ0|CYOE1_PSEPG | Protoheme IX farnesyltransferase 1 OS=Pseudomonas putida (strain GB-1) GN=cyoE1 PE=3 SV=1 | 108 | 348 | 2.0E-14 |
sp|A7N2M2|CYOE1_VIBCB | Protoheme IX farnesyltransferase 1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cyoE1 PE=3 SV=1 | 163 | 364 | 2.0E-14 |
sp|A6V8N8|CYOE2_PSEA7 | Protoheme IX farnesyltransferase 2 OS=Pseudomonas aeruginosa (strain PA7) GN=cyoE2 PE=3 SV=1 | 145 | 370 | 2.0E-14 |
sp|B7KVJ7|COXX_METC4 | Protoheme IX farnesyltransferase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=ctaB PE=3 SV=1 | 104 | 396 | 2.0E-14 |
sp|Q1RI93|COXX_RICBR | Protoheme IX farnesyltransferase OS=Rickettsia bellii (strain RML369-C) GN=ctaB PE=3 SV=1 | 110 | 392 | 2.0E-14 |
sp|A4Z2D2|COXX_BRASO | Protoheme IX farnesyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=ctaB PE=3 SV=1 | 86 | 403 | 2.0E-14 |
sp|Q6NH44|COXX_CORDI | Protoheme IX farnesyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=ctaB PE=3 SV=2 | 162 | 383 | 3.0E-14 |
sp|Q3IRC9|COXX1_NATPD | Protoheme IX farnesyltransferase 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ctaB1 PE=3 SV=1 | 108 | 378 | 3.0E-14 |
sp|Q1GTA5|COXX_SPHAL | Protoheme IX farnesyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=ctaB PE=3 SV=1 | 106 | 324 | 3.0E-14 |
sp|B1ZKN8|COXX_METPB | Protoheme IX farnesyltransferase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=ctaB PE=3 SV=1 | 104 | 396 | 3.0E-14 |
sp|A8GVN8|COXX_RICB8 | Protoheme IX farnesyltransferase OS=Rickettsia bellii (strain OSU 85-389) GN=ctaB PE=3 SV=1 | 110 | 392 | 3.0E-14 |
sp|Q3K773|CYOE2_PSEPF | Protoheme IX farnesyltransferase 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=cyoE2 PE=3 SV=1 | 152 | 411 | 4.0E-14 |
sp|Q1IGZ4|CYOE1_PSEE4 | Protoheme IX farnesyltransferase 1 OS=Pseudomonas entomophila (strain L48) GN=cyoE1 PE=3 SV=1 | 108 | 348 | 4.0E-14 |
sp|Q0S0I5|COXX_RHOJR | Protoheme IX farnesyltransferase OS=Rhodococcus jostii (strain RHA1) GN=ctaB PE=3 SV=2 | 108 | 380 | 6.0E-14 |
sp|Q8Y2G4|COXX_RALSO | Protoheme IX farnesyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=ctaB PE=3 SV=2 | 88 | 380 | 6.0E-14 |
sp|A1SBD7|CYOE_SHEAM | Protoheme IX farnesyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cyoE PE=3 SV=1 | 88 | 398 | 7.0E-14 |
sp|Q6AF34|COXX_LEIXX | Protoheme IX farnesyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=ctaB PE=3 SV=1 | 102 | 325 | 8.0E-14 |
sp|A9HKH7|COXX_GLUDA | Protoheme IX farnesyltransferase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=ctaB PE=3 SV=1 | 108 | 334 | 8.0E-14 |
sp|B1JHT2|CYOE_YERPY | Protoheme IX farnesyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cyoE PE=3 SV=1 | 152 | 396 | 8.0E-14 |
sp|A7FLD4|CYOE_YERP3 | Protoheme IX farnesyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cyoE PE=3 SV=1 | 152 | 396 | 8.0E-14 |
sp|A0AKG3|COXX_LISW6 | Protoheme IX farnesyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=ctaB PE=3 SV=1 | 150 | 324 | 8.0E-14 |
sp|Q66DU5|CYOE_YERPS | Protoheme IX farnesyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cyoE PE=3 SV=1 | 152 | 396 | 9.0E-14 |
sp|A4TPF3|CYOE_YERPP | Protoheme IX farnesyltransferase OS=Yersinia pestis (strain Pestoides F) GN=cyoE PE=3 SV=2 | 152 | 396 | 9.0E-14 |
sp|Q1CL75|CYOE_YERPN | Protoheme IX farnesyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cyoE PE=3 SV=2 | 152 | 396 | 9.0E-14 |
sp|Q0WCB5|CYOE_YERPE | Protoheme IX farnesyltransferase OS=Yersinia pestis GN=cyoE PE=3 SV=1 | 152 | 396 | 9.0E-14 |
sp|Q1C4J8|CYOE_YERPA | Protoheme IX farnesyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cyoE PE=3 SV=2 | 152 | 396 | 9.0E-14 |
sp|Q1LTJ4|CYOE_BAUCH | Protoheme IX farnesyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cyoE PE=3 SV=1 | 151 | 408 | 1.0E-13 |
sp|A5GRR8|COXX_SYNR3 | Protoheme IX farnesyltransferase OS=Synechococcus sp. (strain RCC307) GN=ctaB PE=3 SV=1 | 97 | 399 | 1.0E-13 |
sp|Q7VDD5|COXX_PROMA | Protoheme IX farnesyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ctaB PE=3 SV=1 | 108 | 413 | 1.0E-13 |
sp|B3PSB2|COXX_RHIE6 | Protoheme IX farnesyltransferase OS=Rhizobium etli (strain CIAT 652) GN=ctaB PE=3 SV=1 | 108 | 403 | 1.0E-13 |
sp|B8DH72|COXX_LISMH | Protoheme IX farnesyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=ctaB PE=3 SV=1 | 150 | 324 | 1.0E-13 |
sp|Q71XV7|COXX_LISMF | Protoheme IX farnesyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ctaB PE=3 SV=1 | 150 | 324 | 1.0E-13 |
sp|C1KX10|COXX_LISMC | Protoheme IX farnesyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=ctaB PE=3 SV=1 | 150 | 324 | 1.0E-13 |
sp|Q929W0|COXX_LISIN | Protoheme IX farnesyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ctaB PE=3 SV=1 | 150 | 324 | 1.0E-13 |
sp|Q15N01|CYOE2_PSEA6 | Protoheme IX farnesyltransferase 2 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cyoE2 PE=3 SV=1 | 109 | 368 | 2.0E-13 |
sp|Q8Y5K3|COXX_LISMO | Protoheme IX farnesyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ctaB PE=3 SV=1 | 150 | 324 | 2.0E-13 |
sp|Q83CV6|CYOE_COXBU | Protoheme IX farnesyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=cyoE PE=3 SV=1 | 108 | 399 | 2.0E-13 |
sp|A9NCT0|CYOE_COXBR | Protoheme IX farnesyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=cyoE PE=3 SV=1 | 108 | 399 | 2.0E-13 |
sp|A9KCC9|CYOE_COXBN | Protoheme IX farnesyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=cyoE PE=3 SV=1 | 108 | 399 | 2.0E-13 |
sp|B6J085|CYOE_COXB2 | Protoheme IX farnesyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=cyoE PE=3 SV=1 | 108 | 399 | 2.0E-13 |
sp|B6J736|CYOE_COXB1 | Protoheme IX farnesyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=cyoE PE=3 SV=1 | 108 | 399 | 2.0E-13 |
sp|Q6MBY2|COXX_PARUW | Protoheme IX farnesyltransferase OS=Protochlamydia amoebophila (strain UWE25) GN=ctaB PE=3 SV=1 | 157 | 343 | 2.0E-13 |
sp|A6WC46|COXX_KINRD | Protoheme IX farnesyltransferase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=ctaB PE=3 SV=1 | 105 | 381 | 2.0E-13 |
sp|Q7P0G0|COXX1_CHRVO | Protoheme IX farnesyltransferase 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ctaB1 PE=3 SV=1 | 101 | 399 | 2.0E-13 |
sp|A4ILX0|COXX_GEOTN | Protoheme IX farnesyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=ctaB PE=3 SV=1 | 146 | 324 | 3.0E-13 |
sp|Q5P9Y8|COXX_ANAMM | Protoheme IX farnesyltransferase OS=Anaplasma marginale (strain St. Maries) GN=ctaB PE=3 SV=1 | 108 | 399 | 3.0E-13 |
sp|B9KGP6|COXX_ANAMF | Protoheme IX farnesyltransferase OS=Anaplasma marginale (strain Florida) GN=ctaB PE=3 SV=1 | 108 | 399 | 3.0E-13 |
sp|Q67ML5|COXX_SYMTH | Protoheme IX farnesyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ctaB PE=3 SV=1 | 102 | 382 | 3.0E-13 |
sp|A4IZX0|CYOE_FRATW | Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=cyoE PE=3 SV=1 | 151 | 402 | 3.0E-13 |
sp|Q0BNW5|CYOE_FRATO | Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=cyoE PE=3 SV=1 | 151 | 402 | 3.0E-13 |
sp|A0Q4E4|CYOE_FRATN | Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=cyoE PE=3 SV=1 | 151 | 402 | 3.0E-13 |
sp|A7GNP0|COXX1_BACCN | Protoheme IX farnesyltransferase 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ctaB1 PE=3 SV=1 | 111 | 324 | 3.0E-13 |
sp|C5D862|COXX_GEOSW | Protoheme IX farnesyltransferase OS=Geobacillus sp. (strain WCH70) GN=ctaB PE=3 SV=1 | 82 | 324 | 4.0E-13 |
sp|Q2A5L1|CYOE_FRATH | Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=cyoE PE=3 SV=1 | 151 | 402 | 4.0E-13 |
sp|Q7NQZ3|COXX2_CHRVO | Protoheme IX farnesyltransferase 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ctaB2 PE=3 SV=1 | 155 | 405 | 4.0E-13 |
sp|A7N9N4|CYOE_FRATF | Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=cyoE PE=3 SV=1 | 151 | 402 | 5.0E-13 |
sp|Q5WDX4|COXX_BACSK | Protoheme IX farnesyltransferase OS=Bacillus clausii (strain KSM-K16) GN=ctaB PE=3 SV=1 | 85 | 324 | 5.0E-13 |
sp|Q6A7G0|COXX_PROAC | Protoheme IX farnesyltransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=ctaB PE=3 SV=2 | 77 | 380 | 6.0E-13 |
sp|A5VD56|COXX_SPHWW | Protoheme IX farnesyltransferase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=ctaB PE=3 SV=1 | 106 | 362 | 6.0E-13 |
sp|Q7N0K3|CYOE_PHOLL | Protoheme IX farnesyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cyoE PE=3 SV=1 | 157 | 396 | 6.0E-13 |
sp|Q5NI07|CYOE_FRATT | Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=cyoE PE=3 SV=1 | 151 | 402 | 7.0E-13 |
sp|Q14JF9|CYOE_FRAT1 | Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=cyoE PE=3 SV=1 | 151 | 402 | 7.0E-13 |
sp|B0REI2|COXX_CLAMS | Protoheme IX farnesyltransferase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=ctaB PE=3 SV=1 | 102 | 325 | 7.0E-13 |
sp|B9JAP1|COXX_AGRRK | Protoheme IX farnesyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ctaB PE=3 SV=1 | 108 | 403 | 8.0E-13 |
sp|Q9ZDI2|COXX_RICPR | Protoheme IX farnesyltransferase OS=Rickettsia prowazekii (strain Madrid E) GN=ctaB PE=3 SV=1 | 110 | 405 | 8.0E-13 |
sp|Q6F9R1|CYOE_ACIAD | Protoheme IX farnesyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cyoE PE=3 SV=2 | 163 | 408 | 8.0E-13 |
sp|A9WAQ6|COXX_CHLAA | Protoheme IX farnesyltransferase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=ctaB PE=3 SV=1 | 168 | 403 | 9.0E-13 |
sp|Q819N1|COXX_BACCR | Protoheme IX farnesyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ctaB PE=3 SV=2 | 151 | 356 | 9.0E-13 |
sp|B9IW24|COXX_BACCQ | Protoheme IX farnesyltransferase OS=Bacillus cereus (strain Q1) GN=ctaB PE=3 SV=1 | 151 | 356 | 9.0E-13 |
sp|B7HMC9|COXX_BACC7 | Protoheme IX farnesyltransferase OS=Bacillus cereus (strain AH187) GN=ctaB PE=3 SV=1 | 151 | 356 | 9.0E-13 |
sp|B7H6T1|COXX_BACC4 | Protoheme IX farnesyltransferase OS=Bacillus cereus (strain B4264) GN=ctaB PE=3 SV=1 | 151 | 356 | 9.0E-13 |
sp|Q732C2|COXX_BACC1 | Protoheme IX farnesyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ctaB PE=3 SV=1 | 151 | 356 | 9.0E-13 |
sp|Q2KBM1|COXX_RHIEC | Protoheme IX farnesyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ctaB PE=3 SV=1 | 108 | 403 | 9.0E-13 |
sp|A5CRS6|COXX_CLAM3 | Protoheme IX farnesyltransferase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=ctaB PE=3 SV=1 | 102 | 325 | 9.0E-13 |
sp|Q5L114|COXX_GEOKA | Protoheme IX farnesyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=ctaB PE=3 SV=1 | 82 | 355 | 9.0E-13 |
sp|C1EPV9|COXX_BACC3 | Protoheme IX farnesyltransferase OS=Bacillus cereus (strain 03BB102) GN=ctaB PE=3 SV=1 | 151 | 356 | 9.0E-13 |
sp|A0RHW3|COXX_BACAH | Protoheme IX farnesyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=ctaB PE=3 SV=2 | 151 | 356 | 9.0E-13 |
sp|Q6HEL9|COXX_BACHK | Protoheme IX farnesyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ctaB PE=3 SV=1 | 151 | 356 | 1.0E-12 |
sp|Q635Y1|COXX_BACCZ | Protoheme IX farnesyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=ctaB PE=3 SV=1 | 151 | 356 | 1.0E-12 |
sp|B7JK33|COXX_BACC0 | Protoheme IX farnesyltransferase OS=Bacillus cereus (strain AH820) GN=ctaB PE=3 SV=1 | 151 | 356 | 1.0E-12 |
sp|Q81MT8|COXX_BACAN | Protoheme IX farnesyltransferase OS=Bacillus anthracis GN=ctaB PE=3 SV=1 | 151 | 356 | 1.0E-12 |
sp|C3LI11|COXX_BACAC | Protoheme IX farnesyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=ctaB PE=3 SV=1 | 151 | 356 | 1.0E-12 |
sp|C3P6V2|COXX_BACAA | Protoheme IX farnesyltransferase OS=Bacillus anthracis (strain A0248) GN=ctaB PE=3 SV=1 | 151 | 356 | 1.0E-12 |
sp|B7IVI2|COXX_BACC2 | Protoheme IX farnesyltransferase OS=Bacillus cereus (strain G9842) GN=ctaB PE=3 SV=1 | 151 | 356 | 1.0E-12 |
sp|Q1MKI5|COXX_RHIL3 | Protoheme IX farnesyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ctaB PE=3 SV=1 | 108 | 403 | 1.0E-12 |
sp|Q8F9F8|COXX_LEPIN | Protoheme IX farnesyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=ctaB PE=3 SV=1 | 112 | 404 | 1.0E-12 |
sp|Q72VU2|COXX_LEPIC | Protoheme IX farnesyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=ctaB PE=3 SV=1 | 112 | 404 | 1.0E-12 |
sp|A2BVA8|COXX_PROM5 | Protoheme IX farnesyltransferase OS=Prochlorococcus marinus (strain MIT 9515) GN=ctaB PE=3 SV=1 | 97 | 410 | 1.0E-12 |
sp|A9CJX3|COXX_AGRFC | Protoheme IX farnesyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ctaB PE=3 SV=1 | 108 | 324 | 2.0E-12 |
sp|Q0BPU7|COXX_GRABC | Protoheme IX farnesyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ctaB PE=3 SV=2 | 108 | 407 | 2.0E-12 |
sp|Q089I2|CYOE1_SHEFN | Protoheme IX farnesyltransferase 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=cyoE1 PE=3 SV=1 | 149 | 402 | 2.0E-12 |
sp|A8EZ97|COXX_RICCK | Protoheme IX farnesyltransferase OS=Rickettsia canadensis (strain McKiel) GN=ctaB PE=3 SV=1 | 110 | 395 | 2.0E-12 |
sp|Q7VRH6|CYOE_BLOFL | Protoheme IX farnesyltransferase OS=Blochmannia floridanus GN=cyoE PE=3 SV=1 | 146 | 383 | 3.0E-12 |
sp|Q4L5D0|COXX_STAHJ | Protoheme IX farnesyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ctaB PE=3 SV=1 | 151 | 337 | 3.0E-12 |
sp|B0SMP1|COXX_LEPBP | Protoheme IX farnesyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=ctaB PE=3 SV=2 | 109 | 411 | 3.0E-12 |
sp|B0SE58|COXX_LEPBA | Protoheme IX farnesyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=ctaB PE=3 SV=2 | 109 | 411 | 3.0E-12 |
sp|A8GRQ1|COXX_RICRS | Protoheme IX farnesyltransferase OS=Rickettsia rickettsii (strain Sheila Smith) GN=ctaB PE=3 SV=1 | 110 | 364 | 3.0E-12 |
sp|B0BX58|COXX_RICRO | Protoheme IX farnesyltransferase OS=Rickettsia rickettsii (strain Iowa) GN=ctaB PE=3 SV=1 | 110 | 364 | 3.0E-12 |
sp|A5G0I2|COXX_ACICJ | Protoheme IX farnesyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=ctaB PE=3 SV=1 | 108 | 348 | 3.0E-12 |
sp|Q49WP1|COXX_STAS1 | Protoheme IX farnesyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ctaB PE=3 SV=1 | 151 | 339 | 3.0E-12 |
sp|Q493G3|CYOE_BLOPB | Protoheme IX farnesyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=cyoE PE=3 SV=1 | 152 | 386 | 3.0E-12 |
sp|Q8NX68|COXX_STAAW | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain MW2) GN=ctaB PE=3 SV=1 | 136 | 337 | 4.0E-12 |
sp|A8Z1Q1|COXX_STAAT | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ctaB PE=3 SV=1 | 136 | 337 | 4.0E-12 |
sp|Q6GA98|COXX_STAAS | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=ctaB PE=3 SV=1 | 136 | 337 | 4.0E-12 |
sp|Q6GHW9|COXX_STAAR | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=ctaB PE=3 SV=1 | 136 | 337 | 4.0E-12 |
sp|Q7A664|COXX_STAAN | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain N315) GN=ctaB PE=3 SV=2 | 136 | 337 | 4.0E-12 |
sp|Q99UY7|COXX_STAAM | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ctaB PE=3 SV=2 | 136 | 337 | 4.0E-12 |
sp|A6QFX1|COXX_STAAE | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain Newman) GN=ctaB PE=3 SV=1 | 136 | 337 | 4.0E-12 |
sp|Q5HGW8|COXX_STAAC | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain COL) GN=ctaB PE=3 SV=1 | 136 | 337 | 4.0E-12 |
sp|Q2YX83|COXX_STAAB | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ctaB PE=3 SV=1 | 136 | 337 | 4.0E-12 |
sp|A5IS03|COXX_STAA9 | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain JH9) GN=ctaB PE=3 SV=1 | 136 | 337 | 4.0E-12 |
sp|Q2G2B9|COXX_STAA8 | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=ctaB PE=3 SV=1 | 136 | 337 | 4.0E-12 |
sp|Q2FHW4|COXX_STAA3 | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain USA300) GN=ctaB PE=3 SV=1 | 136 | 337 | 4.0E-12 |
sp|A6U0T4|COXX_STAA2 | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain JH1) GN=ctaB PE=3 SV=1 | 136 | 337 | 4.0E-12 |
sp|A7X128|COXX_STAA1 | Protoheme IX farnesyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ctaB PE=3 SV=2 | 136 | 337 | 4.0E-12 |
sp|Q92IF1|COXX_RICCN | Protoheme IX farnesyltransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ctaB PE=3 SV=1 | 110 | 364 | 4.0E-12 |
sp|C3PN58|COXX_RICAE | Protoheme IX farnesyltransferase OS=Rickettsia africae (strain ESF-5) GN=ctaB PE=3 SV=1 | 110 | 364 | 4.0E-12 |
sp|Q46GX1|COXX_PROMT | Protoheme IX farnesyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=ctaB PE=3 SV=1 | 97 | 410 | 4.0E-12 |
sp|Q5HQ51|COXX_STAEQ | Protoheme IX farnesyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ctaB PE=3 SV=1 | 136 | 337 | 4.0E-12 |
sp|B0V7G8|CYOE_ACIBY | Protoheme IX farnesyltransferase OS=Acinetobacter baumannii (strain AYE) GN=cyoE PE=3 SV=1 | 163 | 408 | 5.0E-12 |
sp|A3M6Q3|CYOE_ACIBT | Protoheme IX farnesyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=cyoE PE=3 SV=2 | 163 | 408 | 5.0E-12 |
sp|B0VM11|CYOE_ACIBS | Protoheme IX farnesyltransferase OS=Acinetobacter baumannii (strain SDF) GN=cyoE PE=3 SV=1 | 163 | 408 | 5.0E-12 |
sp|B7IBC0|CYOE_ACIB5 | Protoheme IX farnesyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=cyoE PE=3 SV=1 | 163 | 408 | 5.0E-12 |
sp|B7H0K1|CYOE_ACIB3 | Protoheme IX farnesyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=cyoE PE=3 SV=1 | 163 | 408 | 5.0E-12 |
sp|A2C0Q4|COXX_PROM1 | Protoheme IX farnesyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=ctaB PE=3 SV=1 | 97 | 410 | 5.0E-12 |
sp|Q11KD2|COXX_CHESB | Protoheme IX farnesyltransferase OS=Chelativorans sp. (strain BNC1) GN=ctaB PE=3 SV=1 | 106 | 324 | 5.0E-12 |
sp|B2IGJ6|COXX_BEII9 | Protoheme IX farnesyltransferase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=ctaB PE=3 SV=1 | 105 | 324 | 6.0E-12 |
sp|Q8CPM1|COXX_STAES | Protoheme IX farnesyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ctaB PE=3 SV=2 | 136 | 337 | 6.0E-12 |
sp|Q98LF1|COXX1_RHILO | Protoheme IX farnesyltransferase 1 OS=Rhizobium loti (strain MAFF303099) GN=ctaB1 PE=3 SV=1 | 105 | 403 | 7.0E-12 |
sp|A7GRX3|COXX2_BACCN | Protoheme IX farnesyltransferase 2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ctaB2 PE=3 SV=2 | 151 | 356 | 7.0E-12 |
sp|B9EB27|COXX_MACCJ | Protoheme IX farnesyltransferase OS=Macrococcus caseolyticus (strain JCSC5402) GN=ctaB PE=3 SV=1 | 149 | 339 | 8.0E-12 |
sp|B1HST2|COXX2_LYSSC | Protoheme IX farnesyltransferase 2 OS=Lysinibacillus sphaericus (strain C3-41) GN=ctaB2 PE=3 SV=2 | 151 | 324 | 8.0E-12 |
sp|Q4UM22|COXX_RICFE | Protoheme IX farnesyltransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ctaB PE=3 SV=1 | 110 | 364 | 9.0E-12 |
sp|A0KME5|CYOE_AERHH | Protoheme IX farnesyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cyoE PE=3 SV=2 | 148 | 370 | 1.0E-11 |
sp|A8F1B6|COXX_RICM5 | Protoheme IX farnesyltransferase OS=Rickettsia massiliae (strain Mtu5) GN=ctaB PE=3 SV=2 | 110 | 364 | 1.0E-11 |
sp|Q5FPU4|COXX_GLUOX | Protoheme IX farnesyltransferase OS=Gluconobacter oxydans (strain 621H) GN=ctaB PE=3 SV=1 | 108 | 334 | 1.0E-11 |
sp|A3PBH0|COXX_PROM0 | Protoheme IX farnesyltransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=ctaB PE=3 SV=1 | 108 | 410 | 1.0E-11 |
sp|Q31C87|COXX_PROM9 | Protoheme IX farnesyltransferase OS=Prochlorococcus marinus (strain MIT 9312) GN=ctaB PE=3 SV=1 | 108 | 410 | 1.0E-11 |
sp|Q7V2M7|COXX_PROMP | Protoheme IX farnesyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ctaB PE=3 SV=1 | 108 | 410 | 1.0E-11 |
sp|B5ZSV2|COXX_RHILW | Protoheme IX farnesyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ctaB PE=3 SV=1 | 108 | 403 | 2.0E-11 |
sp|B9DPV9|COXX_STACT | Protoheme IX farnesyltransferase OS=Staphylococcus carnosus (strain TM300) GN=ctaB PE=3 SV=1 | 151 | 337 | 2.0E-11 |
sp|A8G3G2|COXX_PROM2 | Protoheme IX farnesyltransferase OS=Prochlorococcus marinus (strain MIT 9215) GN=ctaB PE=3 SV=1 | 108 | 410 | 2.0E-11 |
sp|A6U6U6|COXX_SINMW | Protoheme IX farnesyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=ctaB PE=3 SV=1 | 108 | 324 | 2.0E-11 |
sp|A2BPT0|COXX_PROMS | Protoheme IX farnesyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=ctaB PE=3 SV=1 | 108 | 410 | 2.0E-11 |
sp|A4SPY8|CYOE_AERS4 | Protoheme IX farnesyltransferase OS=Aeromonas salmonicida (strain A449) GN=cyoE PE=3 SV=2 | 148 | 370 | 2.0E-11 |
sp|C3MHJ3|COXX_RHISN | Protoheme IX farnesyltransferase OS=Rhizobium sp. (strain NGR234) GN=ctaB PE=3 SV=1 | 108 | 354 | 2.0E-11 |
sp|Q9CCN4|COXX_MYCLE | Protoheme IX farnesyltransferase OS=Mycobacterium leprae (strain TN) GN=ctaB PE=3 SV=2 | 98 | 390 | 3.0E-11 |
sp|Q0ABY1|CYOE_ALKEH | Protoheme IX farnesyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=cyoE PE=3 SV=2 | 108 | 370 | 3.0E-11 |
sp|A6VRF6|CYOE_MARMS | Protoheme IX farnesyltransferase OS=Marinomonas sp. (strain MWYL1) GN=cyoE PE=3 SV=1 | 157 | 324 | 4.0E-11 |
sp|B0UFS2|COXX_METS4 | Protoheme IX farnesyltransferase OS=Methylobacterium sp. (strain 4-46) GN=ctaB PE=3 SV=1 | 95 | 324 | 4.0E-11 |
sp|Q92RG8|COXX_RHIME | Protoheme IX farnesyltransferase OS=Rhizobium meliloti (strain 1021) GN=ctaB PE=3 SV=2 | 108 | 324 | 6.0E-11 |
sp|Q9HRJ8|COXX_HALSA | Protoheme IX farnesyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=ctaB PE=3 SV=1 | 103 | 341 | 9.0E-11 |
sp|A7NRY4|COXX_ROSCS | Protoheme IX farnesyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=ctaB PE=3 SV=1 | 103 | 415 | 1.0E-10 |
sp|Q2G9W3|COXX_NOVAD | Protoheme IX farnesyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=ctaB PE=3 SV=1 | 106 | 348 | 1.0E-10 |
sp|B0R3W4|COXX_HALS3 | Protoheme IX farnesyltransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=ctaB PE=3 SV=1 | 103 | 324 | 1.0E-10 |
sp|Q055W1|COXX_LEPBL | Protoheme IX farnesyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=ctaB PE=3 SV=1 | 109 | 324 | 1.0E-10 |
sp|Q04PG4|COXX_LEPBJ | Protoheme IX farnesyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ctaB PE=3 SV=1 | 109 | 324 | 1.0E-10 |
sp|Q6KZG0|COXX2_PICTO | Protoheme IX farnesyltransferase 2 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=ctaB2 PE=3 SV=1 | 105 | 324 | 1.0E-10 |
sp|A8GN36|COXX_RICAH | Protoheme IX farnesyltransferase OS=Rickettsia akari (strain Hartford) GN=ctaB PE=3 SV=1 | 110 | 270 | 2.0E-10 |
sp|B8EPK3|COXX_METSB | Protoheme IX farnesyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ctaB PE=3 SV=1 | 108 | 379 | 2.0E-10 |
sp|B1JDU9|CYOE2_PSEPW | Protoheme IX farnesyltransferase 2 OS=Pseudomonas putida (strain W619) GN=cyoE2 PE=3 SV=1 | 152 | 405 | 3.0E-10 |
sp|Q88PN3|CYOE2_PSEPK | Protoheme IX farnesyltransferase 2 OS=Pseudomonas putida (strain KT2440) GN=cyoE2 PE=3 SV=1 | 152 | 405 | 4.0E-10 |
sp|A5VYP1|CYOE2_PSEP1 | Protoheme IX farnesyltransferase 2 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cyoE2 PE=3 SV=1 | 152 | 405 | 4.0E-10 |
sp|B0KPE4|CYOE2_PSEPG | Protoheme IX farnesyltransferase 2 OS=Pseudomonas putida (strain GB-1) GN=cyoE2 PE=3 SV=1 | 152 | 405 | 4.0E-10 |
sp|B1KQ72|CYOE2_SHEWM | Protoheme IX farnesyltransferase 2 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cyoE2 PE=3 SV=2 | 149 | 404 | 4.0E-10 |
sp|Q9WWR5|CYOE_PSEPU | Protoheme IX farnesyltransferase OS=Pseudomonas putida GN=cyoE PE=3 SV=1 | 152 | 405 | 4.0E-10 |
sp|B3CTF6|COXX_ORITI | Protoheme IX farnesyltransferase OS=Orientia tsutsugamushi (strain Ikeda) GN=ctaB PE=3 SV=1 | 105 | 324 | 4.0E-10 |
sp|B1HPV1|COXX1_LYSSC | Protoheme IX farnesyltransferase 1 OS=Lysinibacillus sphaericus (strain C3-41) GN=ctaB1 PE=3 SV=1 | 150 | 343 | 5.0E-10 |
sp|Q15WB8|CYOE1_PSEA6 | Protoheme IX farnesyltransferase 1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cyoE1 PE=3 SV=1 | 149 | 404 | 5.0E-10 |
sp|Q1QYZ3|CYOE_CHRSD | Protoheme IX farnesyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cyoE PE=3 SV=2 | 152 | 405 | 7.0E-10 |
sp|A5CF31|COXX_ORITB | Protoheme IX farnesyltransferase OS=Orientia tsutsugamushi (strain Boryong) GN=ctaB PE=3 SV=1 | 105 | 324 | 8.0E-10 |
sp|A0RZ28|COXX2_CENSY | Protoheme IX farnesyltransferase 2 OS=Cenarchaeum symbiosum (strain A) GN=ctaB2 PE=3 SV=1 | 109 | 324 | 9.0E-10 |
sp|Q1IEP0|CYOE2_PSEE4 | Protoheme IX farnesyltransferase 2 OS=Pseudomonas entomophila (strain L48) GN=cyoE2 PE=3 SV=1 | 152 | 405 | 1.0E-09 |
sp|Q6MR11|COXX_BDEBA | Protoheme IX farnesyltransferase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ctaB PE=3 SV=1 | 157 | 391 | 1.0E-09 |
sp|Q3IHM5|CYOE1_PSEHT | Protoheme IX farnesyltransferase 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cyoE1 PE=3 SV=1 | 157 | 404 | 3.0E-09 |
sp|B8D7Z7|CYOE_BUCAT | Protoheme IX farnesyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=cyoE PE=3 SV=1 | 157 | 321 | 6.0E-09 |
sp|P57540|CYOE_BUCAI | Protoheme IX farnesyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cyoE PE=3 SV=1 | 157 | 321 | 6.0E-09 |
sp|B8D9P5|CYOE_BUCA5 | Protoheme IX farnesyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=cyoE PE=3 SV=1 | 157 | 321 | 6.0E-09 |
sp|Q3INR7|COXX2_NATPD | Protoheme IX farnesyltransferase 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ctaB2 PE=3 SV=1 | 97 | 409 | 7.0E-09 |
sp|B8I9Q3|COXX_METNO | Protoheme IX farnesyltransferase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ctaB PE=3 SV=1 | 104 | 382 | 7.0E-09 |
sp|A5UPV7|COXX_ROSS1 | Protoheme IX farnesyltransferase OS=Roseiflexus sp. (strain RS-1) GN=ctaB PE=3 SV=1 | 103 | 364 | 1.0E-08 |
sp|Q60CP3|CYOE_METCA | Protoheme IX farnesyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cyoE PE=3 SV=1 | 143 | 328 | 2.0E-08 |
sp|A4WIG5|COXX_PYRAR | Protoheme IX farnesyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=ctaB PE=3 SV=2 | 108 | 324 | 7.0E-08 |
sp|A4YI90|COXX_METS5 | Protoheme IX farnesyltransferase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=ctaB PE=3 SV=2 | 109 | 329 | 9.0E-08 |
sp|Q72B27|COXX_DESVH | Protoheme IX farnesyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ctaB PE=3 SV=1 | 138 | 319 | 2.0E-07 |
GO Term | Description | Terminal node |
---|---|---|
GO:0016021 | integral component of membrane | Yes |
GO:0016765 | transferase activity, transferring alkyl or aryl (other than methyl) groups | Yes |
GO:0110165 | cellular anatomical entity | No |
GO:0031224 | intrinsic component of membrane | No |
GO:0005575 | cellular_component | No |
GO:0003824 | catalytic activity | No |
GO:0016740 | transferase activity | No |
GO:0003674 | molecular_function | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 12 | 0.45 |
Domain # | Start | End | Length |
---|---|---|---|
1 | 108 | 130 | 22 |
2 | 150 | 172 | 22 |
3 | 192 | 214 | 22 |
4 | 218 | 237 | 19 |
5 | 244 | 266 | 22 |
6 | 290 | 312 | 22 |
7 | 339 | 361 | 22 |
8 | 390 | 409 | 19 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophio5|2562 MSPLRFSAQLRPWLRRGGPPLSNSPFAVPPGRVASFFFSNRLFEPSACLDAVVRSATVAKIGPHRRRQLARRSTF SSSDLPVNASSALAGAAAAQPPRSLRRLLSSLLSLSKPRLTMLVVLTAMAPYALYPMPEMLSPAITETPSLSPLT LLFLTAGTALCSASANALNMMYEPSTDARMSRTRNRPLVRKLVSTRAAGLFAAFAAVTGAAALYLGVNPTVACLG LANIGLYAGVYTPLKAVTSLNTWAGAIVGGIPPLMGWAAAAGEAATGDGSWRELLLATDGSSVGGWLLAALLFAW QFPHFMALSWPIRDEYRAAGLRMLAWTNPARNARVALRYSLAFVPICLGLCAVGVTQWSYAVTSLPVNLWLIREA VHFWRHQGHAGSARGLFWASVWHLPAVMILALLHKKGMWSRAWKSAFGGSDDGAWEDDDDDDELPEMVTMAAEAT ANKVASTR |
Coding | >Ophio5|2562 ATGTCGCCTTTGCGCTTCTCCGCCCAGCTCCGTCCCTGGCTTCGCCGGGGTGGGCCACCGTTGTCCAATTCGCCG TTTGCTGTGCCGCCGGGCCGCGTCGCCTCATTCTTCTTCTCGAACCGGTTATTCGAACCGTCTGCCTGTCTCGAT GCCGTCGTCCGATCCGCTACCGTTGCGAAAATCGGTCCCCATCGCCGGCGACAGCTGGCTCGGAGGTCCACCTTC TCCTCCTCGGACCTCCCCGTAAACGCCTCCTCGGCCCTCGCCGGTGCTGCCGCCGCTCAGCCTCCCCGATCACTG CGTCGCCTTCTCTCGTCTCTTCTCTCGCTGTCGAAGCCACGGCTGACGATGCTCGTTGTGTTGACCGCCATGGCA CCTTACGCCCTGTATCCGATGCCCGAGATGTTATCGCCCGCCATTACGGAGACGCCCAGCCTCAGTCCGCTGACT CTGCTCTTCCTTACGGCTGGAACGGCCTTGTGCTCTGCCAGCGCAAACGCCCTCAATATGATGTACGAGCCTTCG ACCGATGCCAGGATGTCGCGCACGCGAAACCGCCCGCTGGTCCGCAAGCTCGTGTCGACGCGTGCCGCTGGTCTC TTCGCCGCTTTTGCCGCAGTCACCGGCGCGGCCGCGCTGTATTTGGGCGTAAATCCGACGGTGGCATGTCTCGGT CTCGCCAATATCGGCCTCTACGCCGGTGTATACACGCCTCTCAAGGCCGTCACCTCGCTCAATACGTGGGCCGGC GCCATCGTCGGTGGCATCCCTCCTCTCATGGGCTGGGCCGCGGCCGCTGGCGAGGCTGCCACTGGTGACGGCTCT TGGCGCGAGCTGCTCCTCGCCACCGACGGCTCCTCGGTCGGTGGCTGGCTGCTGGCCGCTCTGCTCTTCGCCTGG CAATTCCCGCACTTCATGGCCCTGAGCTGGCCCATCCGCGACGAGTATCGCGCCGCCGGCCTCCGCATGCTAGCC TGGACCAACCCGGCCCGAAATGCTCGCGTCGCTCTGCGCTACAGCCTGGCTTTCGTGCCCATCTGCCTGGGCCTG TGCGCCGTTGGCGTGACACAATGGTCCTATGCCGTCACCAGCCTGCCCGTCAACCTGTGGCTCATCCGCGAAGCC GTACACTTCTGGAGACATCAGGGCCACGCCGGGAGCGCGAGGGGCCTATTCTGGGCCAGCGTCTGGCATTTGCCG GCCGTCATGATACTGGCGCTGCTGCACAAGAAGGGCATGTGGAGTAGGGCGTGGAAGAGCGCGTTTGGCGGCAGC GACGACGGCGCATGGGAGGATGACGATGACGACGATGAACTGCCAGAGATGGTCACCATGGCGGCTGAGGCGACT GCCAACAAGGTTGCTTCTACGCGG |
Transcript | >Ophio5|2562 ATGTCGCCTTTGCGCTTCTCCGCCCAGCTCCGTCCCTGGCTTCGCCGGGGTGGGCCACCGTTGTCCAATTCGCCG TTTGCTGTGCCGCCGGGCCGCGTCGCCTCATTCTTCTTCTCGAACCGGTTATTCGAACCGTCTGCCTGTCTCGAT GCCGTCGTCCGATCCGCTACCGTTGCGAAAATCGGTCCCCATCGCCGGCGACAGCTGGCTCGGAGGTCCACCTTC TCCTCCTCGGACCTCCCCGTAAACGCCTCCTCGGCCCTCGCCGGTGCTGCCGCCGCTCAGCCTCCCCGATCACTG CGTCGCCTTCTCTCGTCTCTTCTCTCGCTGTCGAAGCCACGGCTGACGATGCTCGTTGTGTTGACCGCCATGGCA CCTTACGCCCTGTATCCGATGCCCGAGATGTTATCGCCCGCCATTACGGAGACGCCCAGCCTCAGTCCGCTGACT CTGCTCTTCCTTACGGCTGGAACGGCCTTGTGCTCTGCCAGCGCAAACGCCCTCAATATGATGTACGAGCCTTCG ACCGATGCCAGGATGTCGCGCACGCGAAACCGCCCGCTGGTCCGCAAGCTCGTGTCGACGCGTGCCGCTGGTCTC TTCGCCGCTTTTGCCGCAGTCACCGGCGCGGCCGCGCTGTATTTGGGCGTAAATCCGACGGTGGCATGTCTCGGT CTCGCCAATATCGGCCTCTACGCCGGTGTATACACGCCTCTCAAGGCCGTCACCTCGCTCAATACGTGGGCCGGC GCCATCGTCGGTGGCATCCCTCCTCTCATGGGCTGGGCCGCGGCCGCTGGCGAGGCTGCCACTGGTGACGGCTCT TGGCGCGAGCTGCTCCTCGCCACCGACGGCTCCTCGGTCGGTGGCTGGCTGCTGGCCGCTCTGCTCTTCGCCTGG CAATTCCCGCACTTCATGGCCCTGAGCTGGCCCATCCGCGACGAGTATCGCGCCGCCGGCCTCCGCATGCTAGCC TGGACCAACCCGGCCCGAAATGCTCGCGTCGCTCTGCGCTACAGCCTGGCTTTCGTGCCCATCTGCCTGGGCCTG TGCGCCGTTGGCGTGACACAATGGTCCTATGCCGTCACCAGCCTGCCCGTCAACCTGTGGCTCATCCGCGAAGCC GTACACTTCTGGAGACATCAGGGCCACGCCGGGAGCGCGAGGGGCCTATTCTGGGCCAGCGTCTGGCATTTGCCG GCCGTCATGATACTGGCGCTGCTGCACAAGAAGGGCATGTGGAGTAGGGCGTGGAAGAGCGCGTTTGGCGGCAGC GACGACGGCGCATGGGAGGATGACGATGACGACGATGAACTGCCAGAGATGGTCACCATGGCGGCTGAGGCGACT GCCAACAAGGTTGCTTCTACGCGGTGA |
Gene | >Ophio5|2562 ATGTCGCCTTTGCGCTTCTCCGCCCAGCTCCGTCCCTGGCTTCGCCGGGGTGGGCCACCGTTGTCCAATTCGCCG TTTGCTGTGCCGCCGGGCCGCGTCGCCTCATTCTTCTTCTCGAACCGGTTATTCGAACCGTCTGCCTGTCTCGAT GCCGTCGTCCGATCCGCTACCGTTGCGAAAATCGGTCCCCATCGCCGGCGACAGCTGGCTCGGAGGTCCACCTTC TCCTCCTCGGACCTCCCCGTAAACGCCTCCTCGGCCCTCGCCGGTGCTGCCGCCGCTCAGCCTCCCCGATCACTG CGTCGCCTTCTCTCGTCTCTTCTCTCGCTGTCGAAGCCACGGCTGACGATGCTCGTTGTGTTGACCGCCATGGCA CCTTACGCCCTGTATCCGATGCCCGAGATGTTATCGCCCGCCATTACGGAGACGCCCAGCCTCAGTCCGCTGACT CTGCTCTTCCTTACGGCTGGAACGGCCTTGTGCTCTGCCAGCGCAAACGCCCTCAATATGATGTACGAGCCTTCG ACCGATGCCAGGATGTCGCGCACGCGAAACCGCCCGCTGGTCCGCAAGCTCGTGTCGACGCGTGCCGCTGGTCTC TTCGCCGCTTTTGCCGCAGTCACCGGCGCGGCCGCGCTGTATTTGGGCGTAAATCCGACGGTGGCATGTCTCGGT CTCGCCAATATCGGCCTCTACGCCGGTGTATACACGCCTCTCAAGGCCGTCACCTCGCTCAATACGTGGGCCGGC GCCATCGTCGGTGGCATCCCTCCTCTCATGGGCTGGGCCGCGGCCGCTGGCGAGGCTGCCACTGGTGACGGCTCT TGGCGCGAGCTGCTCCTCGCCACCGACGGCTCCTCGGTCGGTGGCTGGCTGCTGGCCGCTCTGCTCTTCGCCTGG CAATTCCCGCACTTCATGGCCCTGAGCTGGCCCATCCGCGACGAGTATCGCGCCGCCGGCCTCCGCATGCTAGCC TGGACCAACCCGGCCCGAAATGCTCGCGTCGCTCTGCGCTACAGCCTGGCTTTCGTGCCCATCTGCCTGGGCCTG TGCGCCGTTGGCGTGACACAATGGTCCTATGCCGTCACCAGCCTGCCCGTCAACCTGTGGCTCATCCGCGAAGCC GTACACTTCTGGAGACATCAGGGCCACGCCGGGAGCGCGAGGGGCCTATTCTGGGCCAGCGTCTGGCATTTGCCG GCCGTCATGATACTGGCGCTGCTGCACAAGAAGGGCATGTGGAGTAGGGCGTGGAAGAGCGCGTTTGGCGGCAGC GACGACGGCGCATGGGAGGATGACGATGACGACGATGAACTGCCAGAGATGGTCACCATGGCGGCTGAGGCGACT GCCAACAAGGTTGCTTCTACGCGGTGA |