Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2561
Gene name
Locationscaffold_21:50302..51538
Strand-
Gene length (bp)1236
Transcript length (bp)993
Coding sequence length (bp)990
Protein length (aa) 330

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 7 24 17
2 39 58 19
3 93 115 22
4 130 152 22
5 213 235 22
6 245 267 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 11.68 3.90 19.45
CcL In ants, during behavior modification 5.33 0.21 10.46
CcD In ants, recently dead 6.85 1.90 11.79

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.066536 no
SC16a CcD 0.127842 no
CcL CcD 0.588150 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2561
MAAEEAWAYLAISSAIVMLRLYARLRSPAGGGLHLDDHLMALVIPLFVAVVIIAQVIVTESGNLANNNMTPTQRE
QLDPLSVEFAMRVRGSQLHMAGWILYATLLWTLKFCWLLLYRRFGDRVGRIKLKINLGVVLCASTYLIVVFVVVF
ACRPIDRNWQINPDPGDACYPAVSKAQAAISAMANLGTDIYIISIPLPIVWGARISKTDKTVLGTMFVACLVITM
SIGLARFGLIIANSSEDTSFVGAWSYRECFVAIVITNMPVLFPWTRQRLRRRSKSSDAAVAPMPAPLQSLAIGSE
ETIVQPVEDEDLVETDRKKVEEVDRETLEV
Coding >Ophio5|2561
ATGGCGGCCGAGGAGGCTTGGGCGTATCTAGCTATTAGCTCTGCTATTGTGATGCTACGGCTTTACGCTCGGTTG
CGGAGCCCCGCGGGCGGAGGTTTGCATTTGGATGACCACTTGATGGCGCTGGTGATACCATTATTCGTGGCCGTC
GTTATTATTGCGCAGGTAATTGTGACGGAGTCTGGCAACCTAGCCAACAACAACATGACTCCCACCCAAAGAGAA
CAGCTCGACCCCTTAAGCGTCGAATTCGCAATGCGCGTTCGCGGCTCACAGCTTCACATGGCCGGCTGGATTCTC
TACGCGACGCTGTTGTGGACGCTCAAGTTCTGCTGGCTGCTGCTATATCGCCGCTTCGGGGATCGAGTTGGTCGC
ATCAAGCTCAAGATCAATCTCGGTGTCGTTCTCTGCGCTTCGACTTATCTTATTGTTGTTTTTGTTGTCGTCTTT
GCTTGCAGGCCGATTGATCGCAATTGGCAGATCAATCCGGACCCCGGCGATGCTTGTTATCCTGCCGTTTCCAAG
GCGCAGGCTGCCATCTCAGCCATGGCGAACCTGGGAACCGATATTTATATCATTTCGATTCCGCTGCCGATCGTC
TGGGGAGCCCGCATCTCCAAAACCGACAAAACAGTCCTCGGCACCATGTTCGTCGCCTGCCTCGTCATCACCATG
TCCATCGGACTCGCCCGCTTCGGCCTCATCATAGCCAACTCATCCGAGGACACGAGCTTTGTGGGCGCCTGGTCT
TATCGCGAGTGTTTCGTCGCCATCGTCATCACCAACATGCCCGTGCTATTTCCCTGGACCAGGCAGAGATTGCGG
AGGCGGAGTAAGAGTAGTGACGCTGCTGTCGCTCCGATGCCAGCTCCGCTACAGTCGCTGGCCATTGGCTCCGAG
GAGACGATTGTGCAACCAGTTGAGGATGAGGACCTTGTTGAGACGGATCGAAAGAAGGTCGAGGAGGTAGATCGA
GAGACTCTGGAGGTG
Transcript >Ophio5|2561
ATGGCGGCCGAGGAGGCTTGGGCGTATCTAGCTATTAGCTCTGCTATTGTGATGCTACGGCTTTACGCTCGGTTG
CGGAGCCCCGCGGGCGGAGGTTTGCATTTGGATGACCACTTGATGGCGCTGGTGATACCATTATTCGTGGCCGTC
GTTATTATTGCGCAGGTAATTGTGACGGAGTCTGGCAACCTAGCCAACAACAACATGACTCCCACCCAAAGAGAA
CAGCTCGACCCCTTAAGCGTCGAATTCGCAATGCGCGTTCGCGGCTCACAGCTTCACATGGCCGGCTGGATTCTC
TACGCGACGCTGTTGTGGACGCTCAAGTTCTGCTGGCTGCTGCTATATCGCCGCTTCGGGGATCGAGTTGGTCGC
ATCAAGCTCAAGATCAATCTCGGTGTCGTTCTCTGCGCTTCGACTTATCTTATTGTTGTTTTTGTTGTCGTCTTT
GCTTGCAGGCCGATTGATCGCAATTGGCAGATCAATCCGGACCCCGGCGATGCTTGTTATCCTGCCGTTTCCAAG
GCGCAGGCTGCCATCTCAGCCATGGCGAACCTGGGAACCGATATTTATATCATTTCGATTCCGCTGCCGATCGTC
TGGGGAGCCCGCATCTCCAAAACCGACAAAACAGTCCTCGGCACCATGTTCGTCGCCTGCCTCGTCATCACCATG
TCCATCGGACTCGCCCGCTTCGGCCTCATCATAGCCAACTCATCCGAGGACACGAGCTTTGTGGGCGCCTGGTCT
TATCGCGAGTGTTTCGTCGCCATCGTCATCACCAACATGCCCGTGCTATTTCCCTGGACCAGGCAGAGATTGCGG
AGGCGGAGTAAGAGTAGTGACGCTGCTGTCGCTCCGATGCCAGCTCCGCTACAGTCGCTGGCCATTGGCTCCGAG
GAGACGATTGTGCAACCAGTTGAGGATGAGGACCTTGTTGAGACGGATCGAAAGAAGGTCGAGGAGGTAGATCGA
GAGACTCTGGAGGTGTGA
Gene >Ophio5|2561
ATGGCGGCCGAGGAGGCTTGGGCGTATCTAGCTATTAGCTCTGCTATTGTGATGCTACGGCTTTACGCTCGGTTG
CGGAGCCCCGCGGGCGGAGGTTTGCATTTGGATGACCACTTGATGGCGCTGGTGATAGTGAGTTCATCCGAGTCG
GATCTCTGGCTTGCTTGCTTGCTTGGTACTGACGACAGTGGGATAGCCATTATTCGTGGCCGTCGTTATTATTGC
GCAGGTAATTGTGACGGAGTCTGGCAACCTAGCCAACAACAAGTAAGTTATCCCTTTCTCCTCCTCTTCCTACTC
CTTCCGTTCTCTTCTAACGAAAAAACAGCATGACTCCCACCCAAAGAGAACAGCTCGACCCCTTAAGCGTCGAAT
TCGCAATGCGCGTTCGCGGCTCACAGCTTCACATGGCCGGCTGGATTCTCTACGCGACGCTGTTGTGGACGCTCA
AGTTCTGCTGGCTGCTGCTATATCGCCGCTTCGGGGATCGAGTTGGTCGCATCAAGCTCAAGATCAATCTCGGTG
TCGTTCTCTGCGCTTCGACTTATCTTATTGTTGTTTTTGTTGTCGTCTTTGCTTGCAGGCCGATTGATCGCAATT
GGCAGATCAATCCGGACCCCGGCGGTGAGTTCTTTCGCATACATTCTTTATATGTTCCTCAAGCTGATCTCCTGC
AGATGCTTGTTATCCTGCCGTTTCCAAGGCGCAGGCTGCCATCTCAGCCATGGCGAACCTGGGAACCGATATTTA
TATCATTTCGATTCCGCTGCCGGTAAAGCTCTTCCACTCTTCTTCTTCATCCTTATCCTTCCTCCCAACTGACGA
TCCCCTTCTCAGATCGTCTGGGGAGCCCGCATCTCCAAAACCGACAAAACAGTCCTCGGCACCATGTTCGTCGCC
TGCCTCGTCATCACCATGTCCATCGGACTCGCCCGCTTCGGCCTCATCATAGCCAACTCATCCGAGGACACGAGC
TTTGTGGGCGCCTGGTCTTATCGCGAGTGTTTCGTCGCCATCGTCATCACCAACATGCCCGTGCTATTTCCCTGG
ACCAGGCAGAGATTGCGGAGGCGGAGTAAGAGTAGTGACGCTGCTGTCGCTCCGATGCCAGCTCCGCTACAGTCG
CTGGCCATTGGCTCCGAGGAGACGATTGTGCAACCAGTTGAGGATGAGGACCTTGTTGAGACGGATCGAAAGAAG
GTCGAGGAGGTAGATCGAGAGACTCTGGAGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail