Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2557
Gene name
Locationscaffold_21:42624..43542
Strand+
Gene length (bp)918
Transcript length (bp)918
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01083 Cutinase Cutinase 9.4E-21 25 212

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P9WP43|CUT1_MYCTU Probable cutinase Rv1984c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1984c PE=1 SV=1 25 227 4.0E-07
sp|P9WP42|CUT1_MYCTO Probable cutinase MT2037 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2037 PE=3 SV=1 25 227 4.0E-07
sp|P63880|CUT1_MYCBO Probable cutinase Mb2006c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2006c PE=3 SV=1 25 227 4.0E-07

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2557
MGQGWSFILMVGISGLAASARFTFCHNYVLISARGTRETAGPSLGFTDMIRLTLRQAPGGTEYDVRYPAARDYTQ
VTTLIGTADIRRRIRRGLAACPKQRYALLGYSQGATATLEALREMRGTPAERSISAVLLLGNPYQVPGQLSTVDE
LGGDSTRNRTGALLNLAPGIGLSKEWASSGNALNICYRGDPICSGPGPDTRGKEHIFYGFSFEVQRLGAAFLTER
LKGYRPYVSSRAEQAFEFAALLAELKRRAREKGVVDVKPEEASMSGQEEALPSAGAVRGDEGGGTQMGGWGAREM
VAEGE
Coding >Ophio5|2557
ATGGGCCAAGGCTGGAGCTTCATCCTGATGGTCGGAATCTCTGGGCTGGCAGCCTCGGCTCGCTTCACTTTCTGC
CACAACTACGTGCTCATCAGCGCTCGGGGCACACGCGAGACCGCGGGACCCTCGCTCGGCTTCACCGACATGATC
CGGCTGACGCTGCGTCAGGCACCAGGCGGCACCGAGTACGACGTGCGATACCCGGCCGCTCGCGACTACACGCAG
GTGACGACGCTCATCGGCACGGCGGACATCCGACGGAGGATCCGAAGGGGGCTGGCGGCGTGTCCGAAGCAGCGA
TATGCGCTGCTGGGCTACTCTCAAGGCGCGACGGCGACGCTCGAAGCACTTCGTGAGATGCGTGGCACGCCGGCC
GAACGCTCTATAAGCGCCGTTCTCCTCCTGGGGAATCCTTACCAAGTTCCCGGTCAGTTATCGACAGTGGACGAG
CTGGGCGGAGACTCGACGCGAAACCGGACCGGTGCCCTATTGAATCTCGCACCGGGTATAGGCCTATCAAAGGAA
TGGGCGTCCAGCGGCAACGCGTTAAACATCTGCTACCGCGGCGATCCCATTTGCAGCGGCCCCGGGCCGGACACT
CGAGGGAAAGAGCACATCTTCTACGGCTTCTCGTTCGAGGTGCAACGGCTAGGCGCCGCGTTTTTGACGGAGCGG
CTAAAGGGGTACAGACCGTATGTGTCGTCGAGGGCGGAGCAGGCGTTTGAGTTTGCGGCGCTGCTGGCGGAGTTG
AAGAGGCGGGCGAGGGAGAAAGGGGTAGTTGATGTGAAGCCTGAGGAGGCGTCGATGTCGGGGCAGGAAGAGGCT
TTGCCGTCTGCTGGTGCTGTGCGAGGGGATGAGGGTGGAGGGACGCAGATGGGCGGTTGGGGGGCGCGAGAGATG
GTGGCGGAGGGTGAG
Transcript >Ophio5|2557
ATGGGCCAAGGCTGGAGCTTCATCCTGATGGTCGGAATCTCTGGGCTGGCAGCCTCGGCTCGCTTCACTTTCTGC
CACAACTACGTGCTCATCAGCGCTCGGGGCACACGCGAGACCGCGGGACCCTCGCTCGGCTTCACCGACATGATC
CGGCTGACGCTGCGTCAGGCACCAGGCGGCACCGAGTACGACGTGCGATACCCGGCCGCTCGCGACTACACGCAG
GTGACGACGCTCATCGGCACGGCGGACATCCGACGGAGGATCCGAAGGGGGCTGGCGGCGTGTCCGAAGCAGCGA
TATGCGCTGCTGGGCTACTCTCAAGGCGCGACGGCGACGCTCGAAGCACTTCGTGAGATGCGTGGCACGCCGGCC
GAACGCTCTATAAGCGCCGTTCTCCTCCTGGGGAATCCTTACCAAGTTCCCGGTCAGTTATCGACAGTGGACGAG
CTGGGCGGAGACTCGACGCGAAACCGGACCGGTGCCCTATTGAATCTCGCACCGGGTATAGGCCTATCAAAGGAA
TGGGCGTCCAGCGGCAACGCGTTAAACATCTGCTACCGCGGCGATCCCATTTGCAGCGGCCCCGGGCCGGACACT
CGAGGGAAAGAGCACATCTTCTACGGCTTCTCGTTCGAGGTGCAACGGCTAGGCGCCGCGTTTTTGACGGAGCGG
CTAAAGGGGTACAGACCGTATGTGTCGTCGAGGGCGGAGCAGGCGTTTGAGTTTGCGGCGCTGCTGGCGGAGTTG
AAGAGGCGGGCGAGGGAGAAAGGGGTAGTTGATGTGAAGCCTGAGGAGGCGTCGATGTCGGGGCAGGAAGAGGCT
TTGCCGTCTGCTGGTGCTGTGCGAGGGGATGAGGGTGGAGGGACGCAGATGGGCGGTTGGGGGGCGCGAGAGATG
GTGGCGGAGGGTGAGTAA
Gene >Ophio5|2557
ATGGGCCAAGGCTGGAGCTTCATCCTGATGGTCGGAATCTCTGGGCTGGCAGCCTCGGCTCGCTTCACTTTCTGC
CACAACTACGTGCTCATCAGCGCTCGGGGCACACGCGAGACCGCGGGACCCTCGCTCGGCTTCACCGACATGATC
CGGCTGACGCTGCGTCAGGCACCAGGCGGCACCGAGTACGACGTGCGATACCCGGCCGCTCGCGACTACACGCAG
GTGACGACGCTCATCGGCACGGCGGACATCCGACGGAGGATCCGAAGGGGGCTGGCGGCGTGTCCGAAGCAGCGA
TATGCGCTGCTGGGCTACTCTCAAGGCGCGACGGCGACGCTCGAAGCACTTCGTGAGATGCGTGGCACGCCGGCC
GAACGCTCTATAAGCGCCGTTCTCCTCCTGGGGAATCCTTACCAAGTTCCCGGTCAGTTATCGACAGTGGACGAG
CTGGGCGGAGACTCGACGCGAAACCGGACCGGTGCCCTATTGAATCTCGCACCGGGTATAGGCCTATCAAAGGAA
TGGGCGTCCAGCGGCAACGCGTTAAACATCTGCTACCGCGGCGATCCCATTTGCAGCGGCCCCGGGCCGGACACT
CGAGGGAAAGAGCACATCTTCTACGGCTTCTCGTTCGAGGTGCAACGGCTAGGCGCCGCGTTTTTGACGGAGCGG
CTAAAGGGGTACAGACCGTATGTGTCGTCGAGGGCGGAGCAGGCGTTTGAGTTTGCGGCGCTGCTGGCGGAGTTG
AAGAGGCGGGCGAGGGAGAAAGGGGTAGTTGATGTGAAGCCTGAGGAGGCGTCGATGTCGGGGCAGGAAGAGGCT
TTGCCGTCTGCTGGTGCTGTGCGAGGGGATGAGGGTGGAGGGACGCAGATGGGCGGTTGGGGGGCGCGAGAGATG
GTGGCGGAGGGTGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail