Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2542
Gene name
Locationscaffold_21:8795..9740
Strand-
Gene length (bp)945
Transcript length (bp)888
Coding sequence length (bp)885
Protein length (aa) 295

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 190 212 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 5.28 1.12 9.44
CcL In ants, during behavior modification 13.85 4.23 23.48
CcD In ants, recently dead 5.34 1.17 9.52

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.009817 yes
SC16a CcD 0.986484 no
CcL CcD 0.009347 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2542
MALSTLLHGAIPSMPMTESAMSCAAPVLPTEFERCRIPGGVDFWTSGGFYSPGVCFAGYSALCTQTTASSGGWPI
QAGETAVRCVPKAYKCNAEGEDQRFAVSDFAGTVLSAPAFEIRWRGVDLKKTAAGLLSSSTSRWALPSETVTVSE
STDAITGAGIASTLRAGTTSSSEAVVESAAVPTTAVGHGYIAAIVVGVVAVLLIAGALIGLCVNRRRRKSSKEGR
RADHLEPVEYTGSQRSPVLEMQPAEMDSMPMGPRELPPTPIDRHASQPTAAAHVSGVFEMAAEQAPNAIK
Coding >Ophio5|2542
ATGGCTCTCAGCACTCTCCTCCACGGCGCCATTCCGTCCATGCCCATGACGGAGTCGGCGATGTCCTGCGCAGCT
CCTGTGCTGCCGACCGAATTCGAGCGCTGCCGCATCCCCGGCGGCGTCGACTTCTGGACAAGCGGCGGCTTCTAC
TCGCCCGGTGTATGCTTCGCCGGCTACAGCGCCCTTTGCACGCAGACGACGGCGTCGAGTGGAGGCTGGCCCATC
CAGGCCGGGGAAACGGCAGTCAGATGCGTGCCGAAGGCCTACAAATGCAACGCCGAAGGCGAGGACCAACGCTTC
GCCGTCTCTGATTTTGCCGGCACTGTTCTCTCTGCCCCTGCCTTTGAAATTCGATGGCGAGGGGTGGACCTAAAG
AAAACAGCGGCCGGCCTTCTCTCGTCTTCCACGTCCCGCTGGGCCCTTCCCAGCGAGACCGTGACCGTCTCGGAA
TCTACCGATGCAATTACCGGCGCCGGCATCGCCTCCACTTTGAGAGCCGGCACCACCTCTTCTTCGGAAGCCGTG
GTTGAGTCTGCGGCCGTGCCGACGACCGCCGTCGGCCACGGATACATTGCTGCCATTGTTGTTGGTGTCGTCGCC
GTTCTGCTGATTGCAGGAGCCCTAATCGGGCTCTGTGTTAACAGACGCCGTCGGAAGAGCAGTAAAGAAGGTCGG
AGAGCGGACCACCTGGAACCAGTAGAATACACGGGGTCACAACGGTCACCAGTCCTCGAAATGCAGCCCGCTGAG
ATGGACAGCATGCCGATGGGCCCTCGCGAACTGCCACCCACCCCCATAGATCGCCATGCTTCGCAGCCAACAGCA
GCAGCCCATGTCTCGGGCGTCTTTGAGATGGCTGCTGAGCAAGCGCCAAACGCCATCAAG
Transcript >Ophio5|2542
ATGGCTCTCAGCACTCTCCTCCACGGCGCCATTCCGTCCATGCCCATGACGGAGTCGGCGATGTCCTGCGCAGCT
CCTGTGCTGCCGACCGAATTCGAGCGCTGCCGCATCCCCGGCGGCGTCGACTTCTGGACAAGCGGCGGCTTCTAC
TCGCCCGGTGTATGCTTCGCCGGCTACAGCGCCCTTTGCACGCAGACGACGGCGTCGAGTGGAGGCTGGCCCATC
CAGGCCGGGGAAACGGCAGTCAGATGCGTGCCGAAGGCCTACAAATGCAACGCCGAAGGCGAGGACCAACGCTTC
GCCGTCTCTGATTTTGCCGGCACTGTTCTCTCTGCCCCTGCCTTTGAAATTCGATGGCGAGGGGTGGACCTAAAG
AAAACAGCGGCCGGCCTTCTCTCGTCTTCCACGTCCCGCTGGGCCCTTCCCAGCGAGACCGTGACCGTCTCGGAA
TCTACCGATGCAATTACCGGCGCCGGCATCGCCTCCACTTTGAGAGCCGGCACCACCTCTTCTTCGGAAGCCGTG
GTTGAGTCTGCGGCCGTGCCGACGACCGCCGTCGGCCACGGATACATTGCTGCCATTGTTGTTGGTGTCGTCGCC
GTTCTGCTGATTGCAGGAGCCCTAATCGGGCTCTGTGTTAACAGACGCCGTCGGAAGAGCAGTAAAGAAGGTCGG
AGAGCGGACCACCTGGAACCAGTAGAATACACGGGGTCACAACGGTCACCAGTCCTCGAAATGCAGCCCGCTGAG
ATGGACAGCATGCCGATGGGCCCTCGCGAACTGCCACCCACCCCCATAGATCGCCATGCTTCGCAGCCAACAGCA
GCAGCCCATGTCTCGGGCGTCTTTGAGATGGCTGCTGAGCAAGCGCCAAACGCCATCAAGTAA
Gene >Ophio5|2542
ATGGCTCTCAGCACTCTCCTCCACGGCGCCATTCCGTCCATGCCCATGACGGAGTCGGCGATGTCCTGCGCAGCT
CCTGTGCTGCCGACCGAATTCGAGCGCTGCCGCATCCCCGGCGGCGTCGACTTCTGGACAAGCGGCGGCTTCTAC
TCGCCCGGTGTATGCTTCGCCGGCTACAGCGCCCTTTGCACGCAGACGACGGCGTCGAGTGGAGGCTGGCCCATC
CAGGCCGGGGAAACGGCAGTCAGATGCGTGCCGAAGTGAGACCAGCATCCACATCTCCGCGGGCCTCGTTGCCGC
TGACGACGCGGCTGCAGGGCCTACAAATGCAACGCCGAAGGCGAGGACCAACGCTTCGCCGTCTCTGATTTTGCC
GGCACTGTTCTCTCTGCCCCTGCCTTTGAAATTCGATGGCGAGGGGTGGACCTAAAGAAAACAGCGGCCGGCCTT
CTCTCGTCTTCCACGTCCCGCTGGGCCCTTCCCAGCGAGACCGTGACCGTCTCGGAATCTACCGATGCAATTACC
GGCGCCGGCATCGCCTCCACTTTGAGAGCCGGCACCACCTCTTCTTCGGAAGCCGTGGTTGAGTCTGCGGCCGTG
CCGACGACCGCCGTCGGCCACGGATACATTGCTGCCATTGTTGTTGGTGTCGTCGCCGTTCTGCTGATTGCAGGA
GCCCTAATCGGGCTCTGTGTTAACAGACGCCGTCGGAAGAGCAGTAAAGAAGGTCGGAGAGCGGACCACCTGGAA
CCAGTAGAATACACGGGGTCACAACGGTCACCAGTCCTCGAAATGCAGCCCGCTGAGATGGACAGCATGCCGATG
GGCCCTCGCGAACTGCCACCCACCCCCATAGATCGCCATGCTTCGCAGCCAACAGCAGCAGCCCATGTCTCGGGC
GTCTTTGAGATGGCTGCTGAGCAAGCGCCAAACGCCATCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail