Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2535
Gene name
Locationscaffold_209:22847..23981
Strand+
Gene length (bp)1134
Transcript length (bp)1134
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03690 UPF0160 Uncharacterised protein family (UPF0160) 3.4E-118 24 375

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JK81|MYG1_MOUSE UPF0160 protein MYG1, mitochondrial OS=Mus musculus GN=Myg1 PE=1 SV=1 5 375 2.0E-90
sp|Q9HB07|MYG1_HUMAN UPF0160 protein MYG1, mitochondrial OS=Homo sapiens GN=C12orf10 PE=1 SV=2 20 375 3.0E-89
sp|Q58DG1|MYG1_BOVIN UPF0160 protein MYG1, mitochondrial OS=Bos taurus PE=2 SV=1 20 375 5.0E-89
sp|Q641W2|MYG1_RAT UPF0160 protein MYG1, mitochondrial OS=Rattus norvegicus GN=Myg1 PE=1 SV=1 6 375 1.0E-88
sp|O17606|YK4P_CAEEL UPF0160 protein C27H6.8 OS=Caenorhabditis elegans GN=C27H6.8 PE=3 SV=2 25 377 2.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JK81|MYG1_MOUSE UPF0160 protein MYG1, mitochondrial OS=Mus musculus GN=Myg1 PE=1 SV=1 5 375 2.0E-90
sp|Q9HB07|MYG1_HUMAN UPF0160 protein MYG1, mitochondrial OS=Homo sapiens GN=C12orf10 PE=1 SV=2 20 375 3.0E-89
sp|Q58DG1|MYG1_BOVIN UPF0160 protein MYG1, mitochondrial OS=Bos taurus PE=2 SV=1 20 375 5.0E-89
sp|Q641W2|MYG1_RAT UPF0160 protein MYG1, mitochondrial OS=Rattus norvegicus GN=Myg1 PE=1 SV=1 6 375 1.0E-88
sp|O17606|YK4P_CAEEL UPF0160 protein C27H6.8 OS=Caenorhabditis elegans GN=C27H6.8 PE=3 SV=2 25 377 2.0E-81
sp|Q55G91|U160_DICDI UPF0160 protein OS=Dictyostelium discoideum GN=DDB_G0267768 PE=3 SV=1 20 376 9.0E-80
sp|Q9P7T6|YIW4_SCHPO UPF0160 protein C694.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.04c PE=3 SV=1 25 376 3.0E-78
sp|P40093|YEY6_YEAST UPF0160 protein YER156C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER156C PE=1 SV=1 16 375 1.0E-71
sp|Q9Z862|Y489_CHLPN UPF0160 protein CPn_0489/CP_0265/CPj0489/CpB0509 OS=Chlamydia pneumoniae GN=CPn_0489 PE=3 SV=2 22 358 2.0E-23
sp|Q9PK08|Y665_CHLMU UPF0160 protein TC_0665 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0665 PE=3 SV=2 22 369 1.0E-20
sp|O84391|Y386_CHLTR UPF0160 protein CT_386 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_386 PE=3 SV=2 22 195 4.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2535
MPPLRFLASMTEFVAKRVKMTPPTIGTHNGHFHADEALAVHILRMLPAYSEAALVRTRDPTRLASCHTVVDVGGE
YDVGRRRFDHHQRSFEKVFPGRGTKLSSAGLVFLHFGRAIVARRMGREVEDDVTDNDAIVVADEDDVGMIHRKVY
AGFIEALDAQDNGIDVYDPTALAAAGISQRFSQAGFALSAVVGRRNLTWNDPSVLSSTEADAVQKLEDDHFLAAS
RRIGEEFERELDYCLGSWLPARAIVRRAFADRFRHDVQGRLLVFDNDDLLSPPWKDHLFALEDTAASSPVLYVLY
REKPKLEAKWRIQCVPKSRDSFVSRKPLPEAWRGVRDEDLSSITGIPGCIFVHASGFIGGNATLEGVKEMAAKAL
DV
Coding >Ophio5|2535
ATGCCCCCTCTCCGCTTCCTGGCCTCAATGACCGAGTTCGTCGCCAAACGCGTCAAGATGACTCCCCCGACCATC
GGAACGCACAACGGCCACTTTCACGCCGACGAGGCGCTGGCGGTTCATATACTGCGCATGCTCCCTGCTTACAGT
GAAGCGGCGCTGGTCCGCACCCGCGATCCGACCCGTCTGGCCTCCTGCCACACCGTCGTCGACGTCGGCGGCGAG
TACGATGTCGGCCGTCGGCGCTTCGATCACCACCAGCGCTCCTTTGAAAAGGTGTTTCCCGGACGCGGCACCAAG
CTGTCGAGTGCGGGCCTGGTGTTTTTACACTTTGGCAGGGCTATCGTTGCGCGGAGGATGGGGCGTGAAGTTGAG
GATGATGTTACAGATAATGATGCCATCGTTGTTGCCGACGAGGATGATGTCGGTATGATACACCGCAAGGTTTAC
GCCGGTTTCATCGAGGCTCTAGACGCGCAAGACAACGGCATCGATGTCTACGACCCTACAGCTCTCGCAGCCGCT
GGCATTTCCCAGCGCTTCAGCCAGGCTGGCTTCGCCCTCTCCGCTGTCGTCGGTCGCCGCAATCTTACTTGGAAC
GATCCGAGTGTCCTGTCCAGCACCGAGGCCGATGCGGTGCAGAAACTCGAGGACGACCACTTCCTTGCTGCCAGC
CGCCGCATTGGCGAGGAGTTTGAGCGCGAGCTCGACTACTGTCTTGGTTCTTGGCTGCCCGCCCGCGCTATTGTT
CGACGCGCCTTCGCAGATCGCTTCCGCCACGATGTCCAAGGCCGCTTGCTCGTCTTTGACAATGATGACCTGCTC
TCGCCGCCCTGGAAGGACCACCTCTTCGCTCTCGAGGATACCGCTGCCTCGTCTCCCGTTCTATACGTCCTCTAT
CGCGAGAAGCCCAAGCTCGAAGCCAAGTGGCGCATCCAATGTGTCCCCAAGTCCAGGGACTCCTTTGTTAGCCGC
AAGCCCCTACCCGAGGCCTGGCGCGGTGTTCGCGACGAGGACCTCAGCAGCATCACCGGCATCCCGGGCTGCATC
TTCGTCCACGCCTCTGGCTTCATTGGCGGAAATGCCACATTGGAGGGGGTCAAGGAGATGGCTGCTAAGGCGCTG
GACGTC
Transcript >Ophio5|2535
ATGCCCCCTCTCCGCTTCCTGGCCTCAATGACCGAGTTCGTCGCCAAACGCGTCAAGATGACTCCCCCGACCATC
GGAACGCACAACGGCCACTTTCACGCCGACGAGGCGCTGGCGGTTCATATACTGCGCATGCTCCCTGCTTACAGT
GAAGCGGCGCTGGTCCGCACCCGCGATCCGACCCGTCTGGCCTCCTGCCACACCGTCGTCGACGTCGGCGGCGAG
TACGATGTCGGCCGTCGGCGCTTCGATCACCACCAGCGCTCCTTTGAAAAGGTGTTTCCCGGACGCGGCACCAAG
CTGTCGAGTGCGGGCCTGGTGTTTTTACACTTTGGCAGGGCTATCGTTGCGCGGAGGATGGGGCGTGAAGTTGAG
GATGATGTTACAGATAATGATGCCATCGTTGTTGCCGACGAGGATGATGTCGGTATGATACACCGCAAGGTTTAC
GCCGGTTTCATCGAGGCTCTAGACGCGCAAGACAACGGCATCGATGTCTACGACCCTACAGCTCTCGCAGCCGCT
GGCATTTCCCAGCGCTTCAGCCAGGCTGGCTTCGCCCTCTCCGCTGTCGTCGGTCGCCGCAATCTTACTTGGAAC
GATCCGAGTGTCCTGTCCAGCACCGAGGCCGATGCGGTGCAGAAACTCGAGGACGACCACTTCCTTGCTGCCAGC
CGCCGCATTGGCGAGGAGTTTGAGCGCGAGCTCGACTACTGTCTTGGTTCTTGGCTGCCCGCCCGCGCTATTGTT
CGACGCGCCTTCGCAGATCGCTTCCGCCACGATGTCCAAGGCCGCTTGCTCGTCTTTGACAATGATGACCTGCTC
TCGCCGCCCTGGAAGGACCACCTCTTCGCTCTCGAGGATACCGCTGCCTCGTCTCCCGTTCTATACGTCCTCTAT
CGCGAGAAGCCCAAGCTCGAAGCCAAGTGGCGCATCCAATGTGTCCCCAAGTCCAGGGACTCCTTTGTTAGCCGC
AAGCCCCTACCCGAGGCCTGGCGCGGTGTTCGCGACGAGGACCTCAGCAGCATCACCGGCATCCCGGGCTGCATC
TTCGTCCACGCCTCTGGCTTCATTGGCGGAAATGCCACATTGGAGGGGGTCAAGGAGATGGCTGCTAAGGCGCTG
GACGTCTAG
Gene >Ophio5|2535
ATGCCCCCTCTCCGCTTCCTGGCCTCAATGACCGAGTTCGTCGCCAAACGCGTCAAGATGACTCCCCCGACCATC
GGAACGCACAACGGCCACTTTCACGCCGACGAGGCGCTGGCGGTTCATATACTGCGCATGCTCCCTGCTTACAGT
GAAGCGGCGCTGGTCCGCACCCGCGATCCGACCCGTCTGGCCTCCTGCCACACCGTCGTCGACGTCGGCGGCGAG
TACGATGTCGGCCGTCGGCGCTTCGATCACCACCAGCGCTCCTTTGAAAAGGTGTTTCCCGGACGCGGCACCAAG
CTGTCGAGTGCGGGCCTGGTGTTTTTACACTTTGGCAGGGCTATCGTTGCGCGGAGGATGGGGCGTGAAGTTGAG
GATGATGTTACAGATAATGATGCCATCGTTGTTGCCGACGAGGATGATGTCGGTATGATACACCGCAAGGTTTAC
GCCGGTTTCATCGAGGCTCTAGACGCGCAAGACAACGGCATCGATGTCTACGACCCTACAGCTCTCGCAGCCGCT
GGCATTTCCCAGCGCTTCAGCCAGGCTGGCTTCGCCCTCTCCGCTGTCGTCGGTCGCCGCAATCTTACTTGGAAC
GATCCGAGTGTCCTGTCCAGCACCGAGGCCGATGCGGTGCAGAAACTCGAGGACGACCACTTCCTTGCTGCCAGC
CGCCGCATTGGCGAGGAGTTTGAGCGCGAGCTCGACTACTGTCTTGGTTCTTGGCTGCCCGCCCGCGCTATTGTT
CGACGCGCCTTCGCAGATCGCTTCCGCCACGATGTCCAAGGCCGCTTGCTCGTCTTTGACAATGATGACCTGCTC
TCGCCGCCCTGGAAGGACCACCTCTTCGCTCTCGAGGATACCGCTGCCTCGTCTCCCGTTCTATACGTCCTCTAT
CGCGAGAAGCCCAAGCTCGAAGCCAAGTGGCGCATCCAATGTGTCCCCAAGTCCAGGGACTCCTTTGTTAGCCGC
AAGCCCCTACCCGAGGCCTGGCGCGGTGTTCGCGACGAGGACCTCAGCAGCATCACCGGCATCCCGGGCTGCATC
TTCGTCCACGCCTCTGGCTTCATTGGCGGAAATGCCACATTGGAGGGGGTCAAGGAGATGGCTGCTAAGGCGCTG
GACGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail