Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2533
Gene name
Locationscaffold_209:17158..18060
Strand+
Gene length (bp)902
Transcript length (bp)840
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 55 77 22
3 84 106 22
4 136 158 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 64.65 32.99 96.31
CcL In ants, during behavior modification 138.29 71.77 204.82
CcD In ants, recently dead 88.17 46.46 129.89

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.001217 yes
SC16a CcD 0.212147 no
CcL CcD 0.062161 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2533
MGAKTGVALKSLQWLLRALQFLCAAFILAVFSFFLYTLRTNDLPISDTVRAVEGISGAAALYTIFAMLFVCCVGG
HIMAAATASALDVCFIGAFIFVAFVNRGGLGSCTGFEDTVVGQALAADDARSMPGPKTACMLTTGCFAVAIAIIV
LFVCTALMEVALSRHHRKANRFGPSPANNYTSGYGSKAGALWNRIRFRRKRDDDPNSLPEHTHPDQLDATRRSYG
TETTAIDHATDNPKQDYPTYQPSVANYPSGWHTGAQVHTPPAGYNYNDGVYDRA
Coding >Ophio5|2533
ATGGGCGCCAAAACCGGCGTCGCCCTCAAATCGCTGCAATGGCTCCTCCGCGCTCTTCAGTTCTTGTGTGCCGCC
TTCATCCTCGCCGTCTTCTCCTTCTTCCTGTACACCCTGCGTACCAATGACCTACCCATCTCCGACACCGTCCGC
GCCGTCGAGGGCATCTCCGGAGCGGCCGCTCTCTACACCATCTTCGCCATGCTCTTCGTCTGCTGTGTCGGTGGC
CACATCATGGCCGCTGCTACTGCCTCCGCCCTTGACGTCTGCTTCATAGGCGCCTTCATCTTCGTCGCCTTCGTC
AACAGAGGCGGTCTCGGCTCCTGCACCGGATTTGAAGACACCGTCGTCGGCCAAGCCCTGGCTGCCGACGACGCG
CGCTCTATGCCTGGCCCCAAAACGGCCTGCATGCTCACCACCGGATGTTTTGCCGTCGCCATCGCCATCATCGTC
CTCTTCGTCTGCACCGCCCTCATGGAGGTGGCTCTCTCCCGTCATCATCGAAAAGCCAACCGCTTCGGCCCCAGC
CCGGCCAACAACTACACCTCCGGATATGGATCCAAGGCCGGCGCCCTCTGGAATCGCATCCGTTTCCGTCGCAAG
CGTGATGATGACCCCAACTCTCTCCCAGAGCATACCCACCCTGATCAGCTCGACGCCACCCGCCGCAGCTACGGC
ACCGAGACGACCGCCATTGACCACGCCACCGATAATCCAAAGCAGGACTATCCCACGTACCAGCCCAGCGTCGCA
AATTACCCTTCCGGCTGGCACACGGGCGCTCAGGTCCACACTCCGCCTGCTGGCTACAACTACAACGACGGCGTC
TACGACCGCGCT
Transcript >Ophio5|2533
ATGGGCGCCAAAACCGGCGTCGCCCTCAAATCGCTGCAATGGCTCCTCCGCGCTCTTCAGTTCTTGTGTGCCGCC
TTCATCCTCGCCGTCTTCTCCTTCTTCCTGTACACCCTGCGTACCAATGACCTACCCATCTCCGACACCGTCCGC
GCCGTCGAGGGCATCTCCGGAGCGGCCGCTCTCTACACCATCTTCGCCATGCTCTTCGTCTGCTGTGTCGGTGGC
CACATCATGGCCGCTGCTACTGCCTCCGCCCTTGACGTCTGCTTCATAGGCGCCTTCATCTTCGTCGCCTTCGTC
AACAGAGGCGGTCTCGGCTCCTGCACCGGATTTGAAGACACCGTCGTCGGCCAAGCCCTGGCTGCCGACGACGCG
CGCTCTATGCCTGGCCCCAAAACGGCCTGCATGCTCACCACCGGATGTTTTGCCGTCGCCATCGCCATCATCGTC
CTCTTCGTCTGCACCGCCCTCATGGAGGTGGCTCTCTCCCGTCATCATCGAAAAGCCAACCGCTTCGGCCCCAGC
CCGGCCAACAACTACACCTCCGGATATGGATCCAAGGCCGGCGCCCTCTGGAATCGCATCCGTTTCCGTCGCAAG
CGTGATGATGACCCCAACTCTCTCCCAGAGCATACCCACCCTGATCAGCTCGACGCCACCCGCCGCAGCTACGGC
ACCGAGACGACCGCCATTGACCACGCCACCGATAATCCAAAGCAGGACTATCCCACGTACCAGCCCAGCGTCGCA
AATTACCCTTCCGGCTGGCACACGGGCGCTCAGGTCCACACTCCGCCTGCTGGCTACAACTACAACGACGGCGTC
TACGACCGCGCTTAG
Gene >Ophio5|2533
ATGGGCGCCAAAACCGGCGTCGCCCTCAAATCGCTGCAATGGCTCCTCCGCGCTCTTCAGTTCTTGTGTGCCGCC
TTCATCCTCGCCGTCTTCTCCTTCTTCCTGTACACCCTGCGTACCAATGACCTACCCATCTCCGACACCGTCCGC
GCCGTCGAGGGCATCTCCGGAGCGGCCGCTCTCTACACCATCTTCGCCATGCTCTTCGTCTGCTGTGTCGGTGGC
CACATCATGGCCGCTGCTACTGCCTCCGCCCTTGACGTCTGCTTCATAGGCGCCTTCATCTTCGTCGCCTTCGTC
AACAGAGGCGGTCTCGGCTCCTGCACCGGATTTGAAGACACCGTCGTCGGCCAAGCCCTGGCTGCCGACGACGCG
CGCTCTATGCCTGGCCCCAAAACGGCCTGCATGCTCACCACCGGATGTTTTGCCGTCGCCATCGCCATCATGTAG
GCTCTCCCCGCCCTCTTTTTCCCCTAAATCGGGAACTTGGTTGGCTCATCCATCTCAGCGTCCTCTTCGTCTGCA
CCGCCCTCATGGAGGTGGCTCTCTCCCGTCATCATCGAAAAGCCAACCGCTTCGGCCCCAGCCCGGCCAACAACT
ACACCTCCGGATATGGATCCAAGGCCGGCGCCCTCTGGAATCGCATCCGTTTCCGTCGCAAGCGTGATGATGACC
CCAACTCTCTCCCAGAGCATACCCACCCTGATCAGCTCGACGCCACCCGCCGCAGCTACGGCACCGAGACGACCG
CCATTGACCACGCCACCGATAATCCAAAGCAGGACTATCCCACGTACCAGCCCAGCGTCGCAAATTACCCTTCCG
GCTGGCACACGGGCGCTCAGGTCCACACTCCGCCTGCTGGCTACAACTACAACGACGGCGTCTACGACCGCGCTT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail