Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2532
Gene name
Locationscaffold_209:12076..14900
Strand-
Gene length (bp)2824
Transcript length (bp)2691
Coding sequence length (bp)2688
Protein length (aa) 896

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 3.3E-18 579 654
PF01822 WSC WSC domain 8.0E-15 689 767
PF01822 WSC WSC domain 2.3E-09 796 849
PF00141 peroxidase Peroxidase 1.5E-22 56 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 14 774 0.0E+00
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 564 775 9.0E-30
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 575 850 1.0E-24
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 682 847 5.0E-24
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 687 867 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 14 774 0.0E+00
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 564 775 9.0E-30
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 575 850 1.0E-24
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 682 847 5.0E-24
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 687 867 5.0E-19
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 58 234 5.0E-17
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 546 775 1.0E-16
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 65 194 9.0E-16
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 570 663 1.0E-14
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 573 775 1.0E-12
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 65 191 2.0E-12
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 65 191 2.0E-12
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 60 191 5.0E-12
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 576 775 1.0E-11
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 576 775 1.0E-11
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 557 738 3.0E-11
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 557 792 3.0E-11
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 557 738 3.0E-11
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 65 234 3.0E-11
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 675 847 2.0E-10
sp|A4R606|CCPR2_MAGO7 Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10368 PE=3 SV=1 65 194 2.0E-10
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 65 195 2.0E-10
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 569 738 3.0E-10
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 687 851 2.0E-09
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 689 844 4.0E-09
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 578 676 4.0E-09
sp|Q6C0Z6|CCPR_YARLI Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCP1 PE=3 SV=1 65 195 5.0E-09
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 578 676 8.0E-09
sp|Q4WPF8|CCPR_ASPFU Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccp1 PE=3 SV=1 65 194 1.0E-08
sp|Q7SDV9|CCPR_NEUCR Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccp-1 PE=3 SV=1 65 194 2.0E-08
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 689 844 2.0E-08
sp|Q42593|APXT_ARATH L-ascorbate peroxidase T, chloroplastic OS=Arabidopsis thaliana GN=APXT PE=2 SV=2 65 191 3.0E-08
sp|Q4WLG9|CCPR2_ASPFU Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G13570 PE=3 SV=1 64 194 3.0E-08
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 65 232 4.0E-08
sp|A4QVH4|CCPR_MAGO7 Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CCP1 PE=3 SV=1 65 194 4.0E-08
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 65 232 6.0E-08
sp|Q6CAB5|CCPR2_YARLI Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D04268g PE=3 SV=1 65 194 1.0E-07
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 788 845 2.0E-07
sp|Q42592|APXS_ARATH L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=APXS PE=1 SV=2 40 272 2.0E-07
sp|P0C0L1|APX6_ORYSJ Probable L-ascorbate peroxidase 6, chloroplastic OS=Oryza sativa subsp. japonica GN=APX6 PE=2 SV=1 65 191 3.0E-07
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 39 195 4.0E-07
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 65 191 4.0E-07
sp|Q9SK52|PER18_ARATH Peroxidase 18 OS=Arabidopsis thaliana GN=PER18 PE=3 SV=1 63 217 6.0E-07
sp|P0C0V3|CCPR_EMENI Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccp1 PE=3 SV=1 65 194 6.0E-07
sp|P00431|CCPR_YEAST Cytochrome c peroxidase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCP1 PE=1 SV=2 65 194 8.0E-07
sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 65 195 1.0E-06
sp|Q4HWQ2|CCPR2_GIBZE Putative heme-binding peroxidase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_10606 PE=3 SV=1 65 194 1.0E-06
sp|Q4PBY6|CCPR_USTMA Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP1 PE=3 SV=1 65 194 1.0E-06
sp|Q5B1Z0|CCPR2_EMENI Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN5440 PE=3 SV=1 65 194 1.0E-06
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 59 254 2.0E-06
sp|P0CP54|CCPR_CRYNJ Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCP1 PE=3 SV=1 65 194 2.0E-06
sp|P0CP55|CCPR_CRYNB Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCP1 PE=3 SV=1 65 194 2.0E-06
sp|Q6FMG7|CCPR_CANGA Cytochrome c peroxidase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0K08184g PE=3 SV=1 65 194 2.0E-06
sp|Q9FLC0|PER52_ARATH Peroxidase 52 OS=Arabidopsis thaliana GN=PER52 PE=2 SV=1 29 198 4.0E-06
sp|Q6BIB1|CCPR2_DEBHA Putative heme-binding peroxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2G12166g PE=3 SV=3 65 195 6.0E-06
sp|P00434|PERP7_BRARR Peroxidase P7 OS=Brassica rapa subsp. rapa PE=1 SV=3 29 198 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006979 response to oxidative stress Yes
GO:0004601 peroxidase activity Yes
GO:0020037 heme binding Yes
GO:0006950 response to stress No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0050896 response to stimulus No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003674 molecular_function No
GO:0046906 tetrapyrrole binding No
GO:0016209 antioxidant activity No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2532
MRSSSLLLALGALAIADPTWPSETDELEEIMYQLFSYGARNFADTVSPCSNEASGPGRQNAAEWLRTAFHDAATA
NTYFGTGGVDGSLQYELENGENSGPGHKTTLQFMAPYVSPRASLADLIALGVYTSVRSCGGPVVPFRAGRRDAVA
AGNPGVPQPQNSAFTFQQQFERLGFTKEDMIQLTACGHTLGGVHQTEFPELMPEGGVRNGEAPFDSAVDKFGPNV
VTEYLAGKTVNPLVGGPSAKVNKNSDFKVFNSDGNKTVRAMADPDVFRATCQRVLQKMIDLVPPTVTLSDPITPY
AVKPVGLQLTLADGGSSLVWTGRIRVKTTGLSADAIKSVSITYKDRTGGCASSSCTLGSTVQGVGRGFDDSFAFF
PIEVSIPASSGISSFVVTLHRADGSSTLYDNNGQGYPMHDDVVFQAPQSCVRPSTGSLTVVAAVRNDVAAGGARA
DVWYHEPQSNSPVPRLSRVGVALEKRRCVGHYTLFTTDYAIQGGLASQSHVDVLAGSRTDSFKSLAGVGGTCAEF
DRAAPCVAAEQAFKTLGGRAVNSSVPTTALVPPTPTPAVVAQHRPAVGGYRLVSCWTEGNKTRALSGTTFTNDTM
TLDKCMEFCSKYNYWGTEYGRECYCGNSLSPSSNTAPLSDCNMPCGGNGSEYCGAGDRLELYSTTSAPATPTPTA
TLTHKTTVSSYTLMGCMAEPTSARALSHKTTLAGKTTTNEACAAACAGSRYFGTEYGNECYCGTFVNAGARAAPL
TDCSMACAGDAYQYCGGADRLELYENANATGGTPQQPPAVADFVLVGCRTEGNGTRALGGRVAAADDMTNAKCAG
FCGGATFFGTEYGRECYCGDGLDASIVWCVEPVVCLQEEGAADYAADSAAVIEDEEASLRDRCCGWDEGEG
Coding >Ophio5|2532
ATGCGATCCTCTTCCCTTTTGCTGGCCCTCGGGGCCCTAGCTATCGCCGACCCGACATGGCCGTCTGAAACGGAC
GAGCTCGAGGAAATCATGTACCAGCTCTTCTCCTACGGCGCCCGCAATTTCGCCGACACGGTCAGCCCCTGCTCC
AACGAGGCGTCCGGTCCCGGCCGGCAGAACGCAGCCGAGTGGCTCCGGACGGCCTTTCACGACGCCGCCACGGCA
AACACCTACTTTGGCACCGGCGGCGTCGACGGGTCGCTGCAGTATGAGCTCGAAAATGGTGAGAATTCGGGGCCG
GGACACAAGACTACACTCCAGTTTATGGCGCCGTATGTGTCGCCAAGGGCCAGCCTCGCGGACCTCATTGCGTTG
GGCGTCTACACCTCGGTGCGGTCTTGCGGCGGCCCCGTCGTGCCGTTCCGTGCCGGCCGACGTGATGCCGTCGCG
GCGGGTAATCCCGGCGTGCCTCAACCGCAGAACTCGGCCTTTACCTTCCAGCAGCAGTTCGAGCGCCTCGGCTTC
ACCAAGGAGGATATGATACAGCTGACTGCCTGCGGCCACACTCTTGGCGGGGTCCATCAGACCGAGTTTCCGGAG
CTGATGCCGGAAGGCGGCGTCCGCAATGGCGAGGCCCCCTTCGACTCGGCCGTCGACAAGTTTGGCCCCAACGTC
GTGACCGAGTATCTGGCCGGCAAGACGGTCAACCCCCTTGTCGGAGGGCCCTCGGCCAAGGTGAACAAAAACTCC
GACTTCAAGGTCTTCAACTCGGACGGCAACAAGACGGTCCGCGCCATGGCCGACCCAGACGTCTTCCGCGCTACG
TGCCAGAGGGTGCTGCAGAAGATGATAGACTTGGTGCCTCCCACCGTCACCCTATCCGATCCCATCACCCCTTAC
GCCGTCAAACCCGTCGGCCTGCAACTGACTCTGGCGGACGGCGGCTCGTCCCTCGTCTGGACGGGCCGCATCCGC
GTCAAGACGACGGGCCTTTCCGCCGACGCCATCAAGAGCGTCAGCATCACGTACAAGGACCGCACGGGCGGATGT
GCCAGCTCGTCGTGCACCCTCGGCAGCACCGTCCAGGGTGTAGGCCGTGGCTTCGACGACAGCTTCGCCTTCTTC
CCCATCGAGGTCTCCATTCCCGCCTCGTCTGGCATCTCGTCCTTCGTCGTGACATTGCACCGGGCCGACGGCTCG
AGCACGCTATACGACAACAACGGGCAGGGCTACCCCATGCACGACGATGTCGTCTTCCAGGCGCCGCAGAGCTGT
GTCCGACCATCGACCGGCTCCCTCACCGTCGTCGCCGCCGTCCGCAACGACGTAGCAGCCGGCGGTGCCCGTGCC
GACGTCTGGTATCACGAGCCGCAGAGCAACAGCCCCGTGCCGCGTCTTAGCCGTGTGGGCGTCGCGCTCGAGAAG
CGCCGCTGCGTCGGCCACTACACGCTCTTCACCACCGACTATGCCATCCAGGGAGGCCTGGCGTCTCAGTCGCAC
GTCGACGTCTTGGCCGGTAGTCGCACCGACAGCTTCAAGAGCCTGGCCGGTGTGGGCGGCACCTGCGCCGAGTTC
GACCGCGCCGCACCCTGCGTTGCCGCGGAGCAGGCTTTTAAGACGCTTGGGGGCAGGGCCGTCAACTCGTCGGTT
CCCACTACGGCTCTGGTTCCGCCGACTCCGACGCCGGCTGTCGTCGCCCAGCACAGGCCGGCTGTTGGCGGTTAC
CGGCTGGTGTCGTGCTGGACCGAGGGCAACAAGACGCGGGCCCTGAGCGGAACGACGTTTACCAACGATACCATG
ACGCTGGATAAGTGCATGGAGTTTTGCAGCAAATACAACTACTGGGGGACCGAGTACGGTCGAGAGTGCTACTGC
GGCAACTCGCTCTCACCAAGCAGCAATACAGCGCCGCTATCCGACTGCAACATGCCCTGCGGCGGCAACGGCAGC
GAATACTGCGGCGCGGGAGACCGCCTCGAGCTCTACTCGACCACCAGCGCGCCGGCGACGCCCACGCCCACAGCA
ACGCTCACACACAAGACGACCGTCTCTTCCTACACGCTGATGGGCTGCATGGCGGAACCAACGTCGGCGCGCGCC
CTCTCACATAAGACGACGCTCGCCGGCAAAACGACGACCAATGAGGCCTGCGCGGCCGCCTGCGCCGGCTCACGC
TACTTCGGCACCGAGTACGGCAACGAATGCTACTGCGGCACCTTTGTCAATGCCGGAGCCCGGGCCGCGCCCCTG
ACGGACTGCTCCATGGCCTGCGCCGGAGACGCGTACCAGTACTGCGGCGGCGCAGACCGTCTCGAGCTCTACGAG
AACGCCAACGCGACGGGCGGCACGCCGCAACAGCCCCCGGCCGTCGCCGATTTCGTCCTCGTCGGCTGCCGGACC
GAGGGAAACGGCACGCGCGCGCTGGGCGGACGGGTGGCGGCGGCGGATGACATGACCAACGCCAAGTGCGCGGGC
TTCTGTGGCGGCGCGACCTTTTTCGGAACCGAGTACGGGCGTGAATGCTACTGCGGCGATGGGCTTGACGCGTCG
ATTGTGTGGTGCGTCGAACCGGTTGTCTGTCTACAGGAGGAGGGGGCCGCCGACTACGCCGCCGACTCCGCCGCC
GTCATTGAAGATGAGGAGGCGTCGTTGAGGGATCGTTGTTGTGGTTGGGACGAGGGTGAAGGC
Transcript >Ophio5|2532
ATGCGATCCTCTTCCCTTTTGCTGGCCCTCGGGGCCCTAGCTATCGCCGACCCGACATGGCCGTCTGAAACGGAC
GAGCTCGAGGAAATCATGTACCAGCTCTTCTCCTACGGCGCCCGCAATTTCGCCGACACGGTCAGCCCCTGCTCC
AACGAGGCGTCCGGTCCCGGCCGGCAGAACGCAGCCGAGTGGCTCCGGACGGCCTTTCACGACGCCGCCACGGCA
AACACCTACTTTGGCACCGGCGGCGTCGACGGGTCGCTGCAGTATGAGCTCGAAAATGGTGAGAATTCGGGGCCG
GGACACAAGACTACACTCCAGTTTATGGCGCCGTATGTGTCGCCAAGGGCCAGCCTCGCGGACCTCATTGCGTTG
GGCGTCTACACCTCGGTGCGGTCTTGCGGCGGCCCCGTCGTGCCGTTCCGTGCCGGCCGACGTGATGCCGTCGCG
GCGGGTAATCCCGGCGTGCCTCAACCGCAGAACTCGGCCTTTACCTTCCAGCAGCAGTTCGAGCGCCTCGGCTTC
ACCAAGGAGGATATGATACAGCTGACTGCCTGCGGCCACACTCTTGGCGGGGTCCATCAGACCGAGTTTCCGGAG
CTGATGCCGGAAGGCGGCGTCCGCAATGGCGAGGCCCCCTTCGACTCGGCCGTCGACAAGTTTGGCCCCAACGTC
GTGACCGAGTATCTGGCCGGCAAGACGGTCAACCCCCTTGTCGGAGGGCCCTCGGCCAAGGTGAACAAAAACTCC
GACTTCAAGGTCTTCAACTCGGACGGCAACAAGACGGTCCGCGCCATGGCCGACCCAGACGTCTTCCGCGCTACG
TGCCAGAGGGTGCTGCAGAAGATGATAGACTTGGTGCCTCCCACCGTCACCCTATCCGATCCCATCACCCCTTAC
GCCGTCAAACCCGTCGGCCTGCAACTGACTCTGGCGGACGGCGGCTCGTCCCTCGTCTGGACGGGCCGCATCCGC
GTCAAGACGACGGGCCTTTCCGCCGACGCCATCAAGAGCGTCAGCATCACGTACAAGGACCGCACGGGCGGATGT
GCCAGCTCGTCGTGCACCCTCGGCAGCACCGTCCAGGGTGTAGGCCGTGGCTTCGACGACAGCTTCGCCTTCTTC
CCCATCGAGGTCTCCATTCCCGCCTCGTCTGGCATCTCGTCCTTCGTCGTGACATTGCACCGGGCCGACGGCTCG
AGCACGCTATACGACAACAACGGGCAGGGCTACCCCATGCACGACGATGTCGTCTTCCAGGCGCCGCAGAGCTGT
GTCCGACCATCGACCGGCTCCCTCACCGTCGTCGCCGCCGTCCGCAACGACGTAGCAGCCGGCGGTGCCCGTGCC
GACGTCTGGTATCACGAGCCGCAGAGCAACAGCCCCGTGCCGCGTCTTAGCCGTGTGGGCGTCGCGCTCGAGAAG
CGCCGCTGCGTCGGCCACTACACGCTCTTCACCACCGACTATGCCATCCAGGGAGGCCTGGCGTCTCAGTCGCAC
GTCGACGTCTTGGCCGGTAGTCGCACCGACAGCTTCAAGAGCCTGGCCGGTGTGGGCGGCACCTGCGCCGAGTTC
GACCGCGCCGCACCCTGCGTTGCCGCGGAGCAGGCTTTTAAGACGCTTGGGGGCAGGGCCGTCAACTCGTCGGTT
CCCACTACGGCTCTGGTTCCGCCGACTCCGACGCCGGCTGTCGTCGCCCAGCACAGGCCGGCTGTTGGCGGTTAC
CGGCTGGTGTCGTGCTGGACCGAGGGCAACAAGACGCGGGCCCTGAGCGGAACGACGTTTACCAACGATACCATG
ACGCTGGATAAGTGCATGGAGTTTTGCAGCAAATACAACTACTGGGGGACCGAGTACGGTCGAGAGTGCTACTGC
GGCAACTCGCTCTCACCAAGCAGCAATACAGCGCCGCTATCCGACTGCAACATGCCCTGCGGCGGCAACGGCAGC
GAATACTGCGGCGCGGGAGACCGCCTCGAGCTCTACTCGACCACCAGCGCGCCGGCGACGCCCACGCCCACAGCA
ACGCTCACACACAAGACGACCGTCTCTTCCTACACGCTGATGGGCTGCATGGCGGAACCAACGTCGGCGCGCGCC
CTCTCACATAAGACGACGCTCGCCGGCAAAACGACGACCAATGAGGCCTGCGCGGCCGCCTGCGCCGGCTCACGC
TACTTCGGCACCGAGTACGGCAACGAATGCTACTGCGGCACCTTTGTCAATGCCGGAGCCCGGGCCGCGCCCCTG
ACGGACTGCTCCATGGCCTGCGCCGGAGACGCGTACCAGTACTGCGGCGGCGCAGACCGTCTCGAGCTCTACGAG
AACGCCAACGCGACGGGCGGCACGCCGCAACAGCCCCCGGCCGTCGCCGATTTCGTCCTCGTCGGCTGCCGGACC
GAGGGAAACGGCACGCGCGCGCTGGGCGGACGGGTGGCGGCGGCGGATGACATGACCAACGCCAAGTGCGCGGGC
TTCTGTGGCGGCGCGACCTTTTTCGGAACCGAGTACGGGCGTGAATGCTACTGCGGCGATGGGCTTGACGCGTCG
ATTGTGTGGTGCGTCGAACCGGTTGTCTGTCTACAGGAGGAGGGGGCCGCCGACTACGCCGCCGACTCCGCCGCC
GTCATTGAAGATGAGGAGGCGTCGTTGAGGGATCGTTGTTGTGGTTGGGACGAGGGTGAAGGCTGA
Gene >Ophio5|2532
ATGCGATCCTCTTCCCTTTTGCTGGCCCTCGGGGCCCTAGCTATCGCCGACCCGACATGGCCGTCTGAAACGGAC
GAGCTCGAGGAAATCATGTACCAGCTCTTCTCCTACGGCGCCCGCAATTTCGCCGACACGGTCAGCCCCTGCTCC
AACGAGGCGTCCGGTCCCGGCCGGCAGAACGCAGCCGAGTGGCTCCGGACGGCCTTTCACGACGCCGCCACGGCA
AACACCTACTTTGGCACCGGCGGCGTCGACGGGTCGCTGCAGTATGAGCTCGAAAATGGTGAGAATTCGGGGCCG
GGACACAAGACTACACTCCAGTTTATGGCGCCGTATGTGTCGCCAAGGGCCAGCCTCGCGGACCTCATTGCGTTG
GGCGTCTACACCTCGGTGCGGTCTTGCGGCGGCCCCGTCGTGCCGTTCCGTGCCGGCCGACGTGATGCCGTCGCG
GCGGGTAATCCCGGCGTGCCTCAACCGCAGAACTCGGCCTTTACCTTCCAGCAGCAGTTCGAGCGCCTCGGCTTC
ACCAAGGAGGATATGATACAGCTGACTGCCTGCGGCCACACTCTTGGCGGGGTCCATCAGACCGAGTTTCCGGAG
CTGATGCCGGAAGGCGGCGTCCGCAATGGCGAGGCCCCCTTCGACTCGGCCGTCGACAAGTTTGGCCCCAACGTC
GTGACCGAGTATCTGGCCGGCAAGACGGTCAACCCCCTTGTCGGAGGGCCCTCGGCCAAGGTGAACAAAAACTCC
GACTTCAAGGTCTTCAACTCGGACGGCAACAAGACGGTCCGCGCCATGGCCGACCCAGACGTCTTCCGCGCTACG
TGCCAGAGGGTGCTGCAGAAGATGATAGACTTGGTGCCTCCCACCGTCACCCTATCCGATCCCATCACCCCTTAC
GCCGTCAAACCCGTCGGCCTGCAACTGACTCTGGCGGACGGCGGCTCGTCCCTCGTCTGGACGGGCCGCATCCGC
GTCAAGACGACGGGCCTTTCCGCCGACGCCATCAAGAGCGTCAGCATCACGTACAAGGACCGCACGGGCGGATGT
GCCAGCTCGTCGTGCACCCTCGGCAGCACCGTCCAGGGTGTAGGCCGTGGCTTCGACGACAGCTTCGCCTTCTTC
CCCATCGAGGTCTCCATTCCCGCCTCGTCTGGCATCTCGTCCTTCGTCGTGACATTGCACCGGGCCGACGGCTCG
AGCACGCTATACGACAACAACGGGCAGGGCTACCCCATGCACGACGATGTCGTCTTCCAGGCGCCGCAGAGCTGT
GTCCGACCATCGACCGGCTCCCTCACCGTCGTCGCCGCCGTCCGCAACGACGTAGCAGCCGGCGGTGCCCGTGCC
GACGTCTGGTATCACGAGCCGCAGAGCAACAGCCCCGTGCCGCGTCTTAGCCGTGTGGGCGTCGCGCTCGAGAAG
CGCCGCTGCGTCGGCCACTACACGCTCTTCACCACCGACTATGCCATCCAGGGAGGCCTGGCGTCTCAGTCGCAC
GTCGACGTCTTGGCCGGTAGTCGCACCGACAGCTTCAAGAGCCTGGCCGGTGTGGGCGGCACCTGCGCCGAGTTC
GACCGCGCCGCACCCTGCGTTGCCGCGGAGCAGGCTTTTAAGACGCTTGGGGGCAGGGCCGTCAACTCGTCGGTT
CCCACTACGGCTCTGGTTCCGCCGACTCCGACGCCGGCTGTCGTCGCCCAGCACAGGCCGGCTGTTGGCGGTTAC
CGGCTGGTGTCGTGCTGGACCGAGGGCAACAAGACGCGGGCCCTGAGCGGAACGACGTTTACCAACGATACCATG
ACGCTGGATAAGTGCATGGAGTTTTGCAGCAAATACAACTACTGGGGGACCGAGTACGGTCGAGAGTGTGGGTTT
CTTCCCTTCCCTTTTTTTTTCTTCACCCCTTTCCATGTTGATTTCCTCGCTCACGATTCTCGGCCTCAGGCTACT
GCGGCAACTCGCTCTCACCAAGCAGCAATACAGCGCCGCTATCCGACTGCAACATGCCCTGCGGCGGCAACGGCA
GCGAATACTGCGGCGCGGGAGACCGCCTCGAGCTCTACTCGACCACCAGCGCGCCGGCGACGCCCACGCCCACAG
CAACGCTCACACACAAGACGACCGTCTCTTCCTACACGCTGATGGGCTGCATGGCGGAACCAACGTCGGCGCGCG
CCCTCTCACATAAGACGACGCTCGCCGGCAAAACGACGACCAATGAGGCCTGCGCGGCCGCCTGCGCCGGCTCAC
GCTACTTCGGCACCGAGTACGGCAACGAATGCTACTGCGGCACCTTTGTCAATGCCGGAGCCCGGGCCGCGCCCC
TGACGGACTGCTCCATGGCCTGCGCCGGAGACGCGTACCAGTACTGCGGCGGCGCAGACCGTCTCGAGCTCTACG
AGAACGCCAACGCGACGGGCGGCACGCCGCAACAGCCCCCGGCCGTCGCCGATTTCGTCCTCGTCGGCTGCCGGA
CCGAGGGAAACGGCACGCGCGCGCTGGGCGGACGGGTGGCGGCGGCGGATGACATGACCAACGCCAAGTGCGCGG
GCTTCTGTGGCGGCGCGACCTTTTTCGGAACCGAGTACGGGCGTGAATGCTACTGCGGCGATGGGCTTGACGCGT
CGAGTAAAGAGGCTCCCGCTCTCGAGTGTGGTATGCCGTGTGCAGGGGACGCGACGCAGTTGTGTGGTGCGTCGA
ACCGGTTGTCTGTCTACAGGAGGAGGGGGCCGCCGACTACGCCGCCGACTCCGCCGCCGTCATTGAAGATGAGGA
GGCGTCGTTGAGGGATCGTTGTTGTGGTTGGGACGAGGGTGAAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail