Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2528
Gene name
Locationscaffold_209:3213..4989
Strand+
Gene length (bp)1776
Transcript length (bp)1494
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04042 DNA_pol_E_B DNA polymerase alpha/epsilon subunit B 7.6E-48 215 450
PF18018 DNA_pol_D_N DNA polymerase delta subunit OB-fold domain 1.7E-39 48 185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46957|DPOD2_YEAST DNA polymerase delta small subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL31 PE=1 SV=1 28 493 3.0E-82
sp|Q9LRE5|DPOD2_ORYSJ DNA polymerase delta small subunit OS=Oryza sativa subsp. japonica GN=POLD2 PE=2 SV=1 26 496 2.0E-81
sp|P87324|DPOD2_SCHPO DNA polymerase subunit delta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc1 PE=1 SV=1 42 491 7.0E-81
sp|O48520|DPOD2_ARATH DNA polymerase delta small subunit OS=Arabidopsis thaliana GN=POLD2 PE=2 SV=2 26 497 6.0E-78
sp|P49005|DPOD2_HUMAN DNA polymerase delta subunit 2 OS=Homo sapiens GN=POLD2 PE=1 SV=1 6 484 5.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46957|DPOD2_YEAST DNA polymerase delta small subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL31 PE=1 SV=1 28 493 3.0E-82
sp|Q9LRE5|DPOD2_ORYSJ DNA polymerase delta small subunit OS=Oryza sativa subsp. japonica GN=POLD2 PE=2 SV=1 26 496 2.0E-81
sp|P87324|DPOD2_SCHPO DNA polymerase subunit delta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc1 PE=1 SV=1 42 491 7.0E-81
sp|O48520|DPOD2_ARATH DNA polymerase delta small subunit OS=Arabidopsis thaliana GN=POLD2 PE=2 SV=2 26 497 6.0E-78
sp|P49005|DPOD2_HUMAN DNA polymerase delta subunit 2 OS=Homo sapiens GN=POLD2 PE=1 SV=1 6 484 5.0E-76
sp|Q6AXY4|DPOD2_RAT DNA polymerase delta subunit 2 OS=Rattus norvegicus GN=Pold2 PE=1 SV=1 6 484 7.0E-76
sp|O35654|DPOD2_MOUSE DNA polymerase delta subunit 2 OS=Mus musculus GN=Pold2 PE=1 SV=2 6 484 1.0E-74
sp|O93610|DPOD2_XENLA DNA polymerase delta subunit 2 OS=Xenopus laevis GN=pold2 PE=2 SV=1 27 486 2.0E-74
sp|P49004|DPOD2_BOVIN DNA polymerase delta subunit 2 OS=Bos taurus GN=POLD2 PE=1 SV=2 10 484 2.0E-74
sp|Q9W088|DPOD2_DROME DNA polymerase delta small subunit OS=Drosophila melanogaster GN=CG12018 PE=2 SV=1 26 494 4.0E-68
sp|Q19366|DPOD2_CAEEL Probable DNA polymerase delta small subunit OS=Caenorhabditis elegans GN=F12F6.7 PE=3 SV=1 40 486 6.0E-31
[Show less]

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0003677 DNA binding Yes
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2528
MVALQEASGNLLQPPSHGYPPAAAPRADSSYAPLSSFALDKQRPYQQQYGDMYFLRLTKLRPAVDAVATAAWQGT
VIGGEKARRVERVLDVRQGELCWVSGTVYMDMPLKPNILDDVSKDRWISAPVSTQRYYSDDDVDQIMLEDDSGRV
RLVGDMPRAVPLVTGCIIAVMGTENSSGEFEVIDIKFPDLAPQPDRWALTKRPDASPCSGGNSLIALVSGLSFSA
ADASHALELSLLREFLLGESLAPPVQGEASRISRLIIAGDSVSATAERKVDDDDNDNNSNKKTSKKYGYDASAYN
ALPSQLLDDFLAELLPSLPVTLMPGARDPANASYPQQPMHMAMFPRARRFGPDPSAAVDQPAWFDTVTNPFEAEI
AGWRVLGTAGQNVDDVFKYTESSDRLGMMEAMCRWRCCAPTAPDTLWSYPFQEDDPFVMKTCPHVYFVGCQPDFS
SKLVEGPEGQTVRLVTLPSFADTRELALLDTETLKVSRLKIEVDLDR
Coding >Ophio5|2528
ATGGTTGCCCTACAAGAGGCATCCGGCAACCTTTTACAACCCCCCTCTCATGGCTACCCTCCAGCGGCTGCCCCC
CGAGCCGACTCTTCGTACGCGCCGCTGAGCTCCTTCGCCCTCGACAAGCAGCGGCCGTATCAGCAGCAGTATGGC
GACATGTACTTTCTGCGCCTCACTAAGCTCCGACCCGCCGTCGACGCCGTCGCGACCGCCGCCTGGCAGGGGACT
GTCATTGGCGGCGAGAAGGCGAGGAGGGTGGAACGGGTGCTCGATGTGCGGCAGGGCGAGCTCTGCTGGGTCTCC
GGCACGGTGTATATGGACATGCCGCTGAAGCCGAATATCCTGGATGACGTGTCCAAGGATCGTTGGATCTCGGCC
CCCGTCTCGACGCAGAGGTACTATTCAGACGATGACGTCGACCAAATCATGCTCGAGGACGACTCCGGTCGCGTC
CGGCTGGTGGGCGACATGCCACGGGCCGTGCCTCTGGTCACGGGCTGCATCATCGCCGTCATGGGCACCGAGAAC
AGCAGCGGCGAGTTCGAGGTCATCGACATCAAGTTCCCGGACCTGGCGCCGCAGCCCGACCGCTGGGCTCTAACC
AAGAGGCCGGACGCGTCGCCTTGTTCCGGTGGCAACAGCTTGATTGCCCTCGTCTCGGGCCTCTCGTTTTCCGCC
GCCGACGCGTCGCACGCCCTGGAGCTAAGCCTACTGCGCGAATTCCTCCTCGGCGAATCGTTAGCTCCTCCGGTA
CAGGGCGAGGCTTCGCGCATAAGCCGACTCATCATCGCCGGCGACTCCGTCTCTGCCACCGCCGAGCGCAAAGTC
GACGACGACGACAACGACAACAACAGCAACAAAAAAACCAGCAAAAAATACGGCTACGACGCCAGCGCCTACAAC
GCCCTTCCGTCGCAGCTCCTCGACGATTTTCTTGCTGAGCTTCTCCCCTCGTTGCCCGTGACGCTGATGCCGGGC
GCGAGAGACCCGGCCAACGCGAGCTATCCGCAGCAGCCGATGCACATGGCCATGTTCCCGCGCGCCAGGCGGTTC
GGACCCGATCCGTCGGCGGCCGTCGACCAGCCTGCGTGGTTTGACACCGTCACGAACCCGTTCGAGGCCGAGATT
GCCGGCTGGCGGGTGCTCGGCACGGCGGGCCAGAACGTCGACGACGTCTTTAAATATACCGAGAGCAGTGATCGG
TTGGGTATGATGGAGGCCATGTGTCGATGGAGGTGTTGCGCGCCGACTGCGCCGGACACGCTTTGGAGCTACCCC
TTCCAGGAGGACGACCCGTTTGTGATGAAGACGTGCCCGCACGTTTATTTCGTCGGCTGCCAGCCCGACTTTTCC
TCCAAGCTGGTGGAAGGGCCGGAGGGACAGACGGTGCGGCTCGTCACCCTGCCGTCCTTTGCCGACACGAGGGAG
CTGGCTCTGCTGGATACGGAGACGTTGAAGGTGAGCAGGCTTAAGATTGAGGTTGACCTTGATCGG
Transcript >Ophio5|2528
ATGGTTGCCCTACAAGAGGCATCCGGCAACCTTTTACAACCCCCCTCTCATGGCTACCCTCCAGCGGCTGCCCCC
CGAGCCGACTCTTCGTACGCGCCGCTGAGCTCCTTCGCCCTCGACAAGCAGCGGCCGTATCAGCAGCAGTATGGC
GACATGTACTTTCTGCGCCTCACTAAGCTCCGACCCGCCGTCGACGCCGTCGCGACCGCCGCCTGGCAGGGGACT
GTCATTGGCGGCGAGAAGGCGAGGAGGGTGGAACGGGTGCTCGATGTGCGGCAGGGCGAGCTCTGCTGGGTCTCC
GGCACGGTGTATATGGACATGCCGCTGAAGCCGAATATCCTGGATGACGTGTCCAAGGATCGTTGGATCTCGGCC
CCCGTCTCGACGCAGAGGTACTATTCAGACGATGACGTCGACCAAATCATGCTCGAGGACGACTCCGGTCGCGTC
CGGCTGGTGGGCGACATGCCACGGGCCGTGCCTCTGGTCACGGGCTGCATCATCGCCGTCATGGGCACCGAGAAC
AGCAGCGGCGAGTTCGAGGTCATCGACATCAAGTTCCCGGACCTGGCGCCGCAGCCCGACCGCTGGGCTCTAACC
AAGAGGCCGGACGCGTCGCCTTGTTCCGGTGGCAACAGCTTGATTGCCCTCGTCTCGGGCCTCTCGTTTTCCGCC
GCCGACGCGTCGCACGCCCTGGAGCTAAGCCTACTGCGCGAATTCCTCCTCGGCGAATCGTTAGCTCCTCCGGTA
CAGGGCGAGGCTTCGCGCATAAGCCGACTCATCATCGCCGGCGACTCCGTCTCTGCCACCGCCGAGCGCAAAGTC
GACGACGACGACAACGACAACAACAGCAACAAAAAAACCAGCAAAAAATACGGCTACGACGCCAGCGCCTACAAC
GCCCTTCCGTCGCAGCTCCTCGACGATTTTCTTGCTGAGCTTCTCCCCTCGTTGCCCGTGACGCTGATGCCGGGC
GCGAGAGACCCGGCCAACGCGAGCTATCCGCAGCAGCCGATGCACATGGCCATGTTCCCGCGCGCCAGGCGGTTC
GGACCCGATCCGTCGGCGGCCGTCGACCAGCCTGCGTGGTTTGACACCGTCACGAACCCGTTCGAGGCCGAGATT
GCCGGCTGGCGGGTGCTCGGCACGGCGGGCCAGAACGTCGACGACGTCTTTAAATATACCGAGAGCAGTGATCGG
TTGGGTATGATGGAGGCCATGTGTCGATGGAGGTGTTGCGCGCCGACTGCGCCGGACACGCTTTGGAGCTACCCC
TTCCAGGAGGACGACCCGTTTGTGATGAAGACGTGCCCGCACGTTTATTTCGTCGGCTGCCAGCCCGACTTTTCC
TCCAAGCTGGTGGAAGGGCCGGAGGGACAGACGGTGCGGCTCGTCACCCTGCCGTCCTTTGCCGACACGAGGGAG
CTGGCTCTGCTGGATACGGAGACGTTGAAGGTGAGCAGGCTTAAGATTGAGGTTGACCTTGATCGGTGA
Gene >Ophio5|2528
ATGGTTGCCCTACAAGAGGCATCCGGCAACCTTTTACAACCCCCCTCGTGAGTGTTTTTTTTTCTTCTCCGCCGT
TGCCCGCTCAGTGACTGACTTTACTTCCCCTCTCCCCCCCCTAGTCATGGCTACCCTCCAGCGGCTGCCCCCCGA
GCCGACTCTTCGTACGCGCCGCTGAGCTCCTTCGCCCTCGACAAGCAGCGGCCGTATCAGCAGCAGTATGGCGAC
ATGTACTTTCTGCGCCTCACTAAGCTCCGACCCGCCGTCGACGCCGTCGCGACCGCCGCCTGGCAGGGGACTGTC
ATTGGCGGCGAGAAGGCGAGGAGGGTGGAACGGGTGCTCGATGTGCGGCAGGGCGAGCTCTGCTGGGTCTCCGGC
ACGGTGTATATGGACATGCCGCTGAAGCCGAATATCCTGGATGACGTGTCCAAGGATGTGAGTGTGGCTTTCTCC
TGTGAAATAAAAAAGGACGCTTTTGACTGACGTGGTTTGGTAGCGTTGGATCTCGGCCCCCGTCTCGACGCAGAG
GTACTATTCAGACGATGACGTCGACCAAATCATGCTCGAGGACGACTCCGGTCGCGTCCGGCTGGTGGGCGACAT
GCCACGGGCCGTGCCTCTGGTCACGGGCTGCATCATCGCCGTCATGGGCACCGAGAACAGCAGCGGCGAGTTCGA
GGTCATCGACATCAAGTTCCCGGACCTGGCGCCGCAGCCCGACCGCTGGGCTCTAACCAAGAGGCCGGACGCGTC
GCCTTGTTCCGGTGGCAACAGCTTGATTGCCCTCGTCTCGGGCCTCTCGTTTTCCGCCGCCGACGCGTCGCACGC
CCTGGAGCTAAGCCTACTGCGCGAATTCCTCCTCGGCGAATCGTTAGCTCCTCCGGTACAGGGCGAGGCTTCGCG
CATAAGCCGACTCATCATCGCCGGCGACTCCGTCTCTGCCACCGCCGAGCGCAAAGTCGACGACGACGACAACGA
CAACAACAGCAACAAAAAAACCAGCAAAAAATACGGCTACGACGCCAGCGCCTACAACGCCCTTCCGTCGCAGCT
CCTCGACGATTTTCTTGCTGAGCTTCTCCCCTCGTTGCCCGTGACGCTGATGCCGGGCGCGAGAGACCCGGCCAA
CGCGAGCTATCCGCAGCAGCCGATGCACATGGCCATGTTCCCGCGCGCCAGGCGGTTCGGACCCGATCCGTCGGC
GGCCGTCGACCAGCCTGCGTGGTTTGACACCGTCACGAACCCGTTCGAGGCCGAGATTGCCGGCTGGCGGGTGCT
CGGCACGGCGGGCCAGAACGTCGACGACGTCTTTAAATATACCGAGAGCAGTGATCGGTTGGGTATGATGGAGGC
CATGTGTCGATGGAGGTGTTGCGCGCCGACTGCGCCGGACACGCTTTGTGAGTTTTTTTTTTTTTTAGTTTTTTT
TTAGTTTGTTTTTTTCTCCCCTTTTCGCGGACTGTTGAGCCGCGCTCGTTTTATATATATATATGTGTGTGTGTT
TGTTTATACGGACATACTGACTCTCCCCCCCCCCCTTTCTTCTCAGGGAGCTACCCCTTCCAGGAGGACGACCCG
TTTGTGATGAAGACGTGCCCGCACGTTTATTTCGTCGGCTGCCAGCCCGACTTTTCCTCCAAGCTGGTGGAAGGG
CCGGAGGGACAGACGGTGCGGCTCGTCACCCTGCCGTCCTTTGCCGACACGAGGGAGCTGGCTCTGCTGGATACG
GAGACGTTGAAGGTGAGCAGGCTTAAGATTGAGGTTGACCTTGATCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail