Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2523
Gene name
Locationscaffold_208:17196..19222
Strand-
Gene length (bp)2026
Transcript length (bp)1782
Coding sequence length (bp)1779
Protein length (aa) 593

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 8.7E-14 92 162
PF01266 DAO FAD dependent oxidoreductase 1.5E-07 89 129
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 4.3E-06 88 126
PF00890 FAD_binding_2 FAD binding domain 5.1E-07 90 128
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 9.3E-05 98 139

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Peroxisome Peroxisomal targeting signal 0.4415 0.1468 0.4018 0.1322 0.4154 0.1359 0.2439 0.1742 0.2755 0.6543

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 213 232 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 28.77 15.05 42.50
CcL In ants, during behavior modification 82.16 43.49 120.84
CcD In ants, recently dead 63.16 34.22 92.10

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.273625 no

Orthologs

Orthofinder run ID4
Orthogroup3453
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|762
Ophiocordyceps australis map64 (Brazil) OphauB2|4383
Ophiocordyceps camponoti-floridani Ophcf2|06050
Ophiocordyceps camponoti-rufipedis Ophun1|3149
Ophiocordyceps kimflemingae Ophio5|2523 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6581

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2523
MGTTIDHSPWLFPLACALITLIRHPCIPEQIHDVLDWDSSAATPDVMTQREADRPWRQVVFSSHVVRPMPPKHSS
GRDEMAPLNSKAKHVVIIGGGAAGMSCAATLANHPDRYKVTVLEKSDVVGGQATSIPLDEQKYGAPWMNNGVQGG
SQIFKHTFNFFRQQGFPPQEVQLQVAFGKGDAGFWTNVFPSKLVQRYSADVKKFGFFLKLIKWTMPVLGLVPISI
MLRLLFFSKDFGDKMVYPLIALFLGTGNQTPHVPSAIVERLFDDPNMKLWDYDPTTLLPNLPTMFTFDHLHAFYG
AWKSDLEANGVTFRNGTDVSEVISRTKHGVKLRIRDVATGSSTEETFDDMVLCVLADDALRILGRQATWREKLVL
GGAAFYDDITVTHTDRAYFEKQYETVFKPELCAEPTSDFQKKQIAFAKGEGVEGSGSFQPMYYTFSYQQDPRLIE
MSFNCSNYQHQLKKANHDNKDSFEPVYQTIFLNKDLKHLWTIDDIDEAKVIKKNWWHQLGHRWQHYLRVVPGMMF
INGKNRTCFAGSWTLVNMHELACVSGIAAAYRLGADYKRFDDFAQDFFAKYLLLSHGMMFSRQEKRRH
Coding >Ophio5|2523
ATGGGAACGACAATCGACCATTCCCCTTGGTTGTTCCCCTTGGCTTGCGCCCTTATTACATTGATTCGGCACCCT
TGCATACCAGAACAAATCCATGACGTGCTCGACTGGGACAGCTCCGCGGCTACCCCCGACGTCATGACCCAACGC
GAGGCCGACAGACCCTGGCGACAAGTTGTCTTCTCCTCCCACGTCGTACGTCCAATGCCTCCGAAGCACTCTTCT
GGACGTGACGAAATGGCTCCGCTCAACAGCAAGGCCAAGCATGTCGTGATAATCGGTGGAGGGGCCGCAGGCATG
TCTTGCGCTGCCACGTTGGCAAACCATCCCGATCGTTACAAAGTCACGGTGCTGGAGAAAAGCGACGTGGTCGGC
GGCCAGGCCACGTCAATTCCGCTCGATGAGCAAAAGTACGGCGCACCATGGATGAACAACGGCGTCCAGGGCGGA
TCCCAGATATTCAAGCACACCTTCAACTTCTTCCGCCAGCAGGGCTTCCCACCACAGGAAGTTCAGCTGCAGGTG
GCCTTTGGCAAGGGAGATGCCGGCTTCTGGACAAATGTCTTCCCTAGTAAACTCGTCCAACGGTACTCGGCCGAT
GTCAAGAAGTTTGGCTTTTTCCTCAAGCTCATCAAATGGACCATGCCCGTGCTGGGCCTCGTGCCGATATCCATC
ATGCTGCGTCTGCTCTTCTTCAGTAAGGACTTTGGAGATAAGATGGTATATCCTCTTATTGCCCTGTTCCTCGGA
ACCGGCAACCAAACTCCTCACGTCCCCTCGGCCATCGTCGAGCGTCTCTTCGACGACCCCAACATGAAGCTATGG
GATTACGACCCCACCACCCTACTGCCGAACCTGCCTACCATGTTCACCTTTGACCATCTTCACGCCTTCTACGGC
GCCTGGAAGAGTGACTTGGAGGCCAATGGGGTCACCTTCCGGAACGGCACGGATGTATCTGAAGTCATATCGAGG
ACGAAGCACGGGGTCAAGCTCCGAATTAGGGACGTGGCTACAGGCAGCTCTACAGAGGAGACGTTTGACGACATG
GTTCTTTGTGTTCTGGCCGACGATGCTCTGCGAATACTGGGCCGCCAAGCAACATGGCGTGAAAAGCTGGTCCTC
GGCGGCGCTGCCTTTTACGACGACATCACCGTCACCCATACCGATCGGGCCTACTTCGAAAAGCAGTACGAGACC
GTCTTCAAGCCGGAGCTGTGCGCGGAGCCAACGTCAGATTTCCAGAAGAAGCAGATTGCCTTTGCCAAAGGCGAA
GGGGTTGAAGGCTCGGGCAGCTTCCAGCCCATGTACTACACCTTTTCCTACCAGCAGGACCCGCGCTTGATCGAG
ATGTCCTTCAACTGCAGCAACTACCAACATCAGCTGAAAAAGGCTAACCACGACAACAAAGACAGCTTCGAGCCT
GTCTACCAAACCATCTTCCTGAACAAGGACCTGAAGCACCTGTGGACGATCGACGACATCGATGAGGCAAAGGTC
ATCAAGAAGAACTGGTGGCATCAGCTCGGTCATCGGTGGCAGCATTACCTTCGCGTCGTCCCGGGCATGATGTTC
ATCAATGGGAAGAACCGGACGTGCTTTGCAGGATCCTGGACGCTCGTGAACATGCACGAACTGGCTTGCGTCAGT
GGCATCGCGGCAGCGTACCGCCTCGGAGCTGATTACAAGCGGTTTGACGATTTTGCGCAAGACTTCTTCGCCAAA
TATCTCCTGCTGTCTCATGGGATGATGTTTTCCCGGCAGGAGAAGCGGCGGCAT
Transcript >Ophio5|2523
ATGGGAACGACAATCGACCATTCCCCTTGGTTGTTCCCCTTGGCTTGCGCCCTTATTACATTGATTCGGCACCCT
TGCATACCAGAACAAATCCATGACGTGCTCGACTGGGACAGCTCCGCGGCTACCCCCGACGTCATGACCCAACGC
GAGGCCGACAGACCCTGGCGACAAGTTGTCTTCTCCTCCCACGTCGTACGTCCAATGCCTCCGAAGCACTCTTCT
GGACGTGACGAAATGGCTCCGCTCAACAGCAAGGCCAAGCATGTCGTGATAATCGGTGGAGGGGCCGCAGGCATG
TCTTGCGCTGCCACGTTGGCAAACCATCCCGATCGTTACAAAGTCACGGTGCTGGAGAAAAGCGACGTGGTCGGC
GGCCAGGCCACGTCAATTCCGCTCGATGAGCAAAAGTACGGCGCACCATGGATGAACAACGGCGTCCAGGGCGGA
TCCCAGATATTCAAGCACACCTTCAACTTCTTCCGCCAGCAGGGCTTCCCACCACAGGAAGTTCAGCTGCAGGTG
GCCTTTGGCAAGGGAGATGCCGGCTTCTGGACAAATGTCTTCCCTAGTAAACTCGTCCAACGGTACTCGGCCGAT
GTCAAGAAGTTTGGCTTTTTCCTCAAGCTCATCAAATGGACCATGCCCGTGCTGGGCCTCGTGCCGATATCCATC
ATGCTGCGTCTGCTCTTCTTCAGTAAGGACTTTGGAGATAAGATGGTATATCCTCTTATTGCCCTGTTCCTCGGA
ACCGGCAACCAAACTCCTCACGTCCCCTCGGCCATCGTCGAGCGTCTCTTCGACGACCCCAACATGAAGCTATGG
GATTACGACCCCACCACCCTACTGCCGAACCTGCCTACCATGTTCACCTTTGACCATCTTCACGCCTTCTACGGC
GCCTGGAAGAGTGACTTGGAGGCCAATGGGGTCACCTTCCGGAACGGCACGGATGTATCTGAAGTCATATCGAGG
ACGAAGCACGGGGTCAAGCTCCGAATTAGGGACGTGGCTACAGGCAGCTCTACAGAGGAGACGTTTGACGACATG
GTTCTTTGTGTTCTGGCCGACGATGCTCTGCGAATACTGGGCCGCCAAGCAACATGGCGTGAAAAGCTGGTCCTC
GGCGGCGCTGCCTTTTACGACGACATCACCGTCACCCATACCGATCGGGCCTACTTCGAAAAGCAGTACGAGACC
GTCTTCAAGCCGGAGCTGTGCGCGGAGCCAACGTCAGATTTCCAGAAGAAGCAGATTGCCTTTGCCAAAGGCGAA
GGGGTTGAAGGCTCGGGCAGCTTCCAGCCCATGTACTACACCTTTTCCTACCAGCAGGACCCGCGCTTGATCGAG
ATGTCCTTCAACTGCAGCAACTACCAACATCAGCTGAAAAAGGCTAACCACGACAACAAAGACAGCTTCGAGCCT
GTCTACCAAACCATCTTCCTGAACAAGGACCTGAAGCACCTGTGGACGATCGACGACATCGATGAGGCAAAGGTC
ATCAAGAAGAACTGGTGGCATCAGCTCGGTCATCGGTGGCAGCATTACCTTCGCGTCGTCCCGGGCATGATGTTC
ATCAATGGGAAGAACCGGACGTGCTTTGCAGGATCCTGGACGCTCGTGAACATGCACGAACTGGCTTGCGTCAGT
GGCATCGCGGCAGCGTACCGCCTCGGAGCTGATTACAAGCGGTTTGACGATTTTGCGCAAGACTTCTTCGCCAAA
TATCTCCTGCTGTCTCATGGGATGATGTTTTCCCGGCAGGAGAAGCGGCGGCATTGA
Gene >Ophio5|2523
ATGGGAACGACAATCGACCATTCCCCTTGGTTGTTCCCCTTGGCTTGCGCCCTTATTACATTGATTCGGCACCCT
TGCATACCAGAACAAATCCATGACGTGCTCGACTGGGACAGCTCCGCGGCTACCCCCGACGTCATGACCCAACGC
GAGGCCGACAGACCCTGGCGACAAGTTGTCTTCTCCTCCCACGTCGTACGTCGTACGTCGCACAGCGTCCTGCTT
GTGCAAACGCTCGCCGCCTGCAGCAATGCCTCCGAAGCACTCTTCTGGACGTGACGAAATGGCTCCGCTCAACAG
CAAGGCCAAGCATGTCGTGATAATCGGTGGAGGGGCCGCAGGCATGGTAGGTAGGCTCCGGGCAGCAAGACTCTA
TCGACCCCTATCGACCTTATCGCCCTCTCAGGACCGCCGCATTGACCTAACCTATAGTCTTGCGCTGCCACGTTG
GCAAACCATCCCGATCGTTACAAAGTCACGGTGCTGGAGAAAAGCGACGTGGTCGGCGGCCAGGCCACGTCAATT
CCGCTCGATGAGCAAAAGTACGGCGCACCATGGATGAACAACGGCGTCCAGGGCGGATCCCAGGTCAGCCTCGCC
AGGCCCTAACTCACGTCGCCCGGCTGACGAGGCGTACCGCAGATATTCAAGCACACCTTCAACTTCTTCCGCCAG
CAGGGCTTCCCACCACAGGAAGTTCAGCTGCAGGTGGCCTTTGGCAAGGGAGATGCCGGCTTCTGGACAAATGTC
TTCCCTAGTAAACTCGTCCAACGGTACTCGGCCGATGTCAAGAAGTTTGGCTTTTTCCTCAAGCTCATCAAATGG
ACCATGCCCGTGCTGGGCCTCGTGCCGATATCCATCATGCTGCGTCTGCTCTTCTTCAGTAAGGACTTTGGAGAT
AAGATGGTATATCCTCTTATTGCCCTGTTCCTCGGAACCGGCAACCAAACTCCTCACGTCCCCTCGGCCATCGTC
GAGCGTCTCTTCGACGACCCCAACATGAAGCTATGGGATTACGACCCCACCACCCTACTGCCGAACCTGCCTACC
ATGTTCACCTTTGACCATCTTCACGCCTTCTACGGCGCCTGGAAGAGTGACTTGGAGGCCAATGGGGTCACCTTC
CGGAACGGCACGGATGTATCTGAAGTCATATCGAGGACGAAGCACGGGGTCAAGCTCCGAATTAGGGACGTGGCT
ACAGGCAGCTCTACAGAGGAGACGTTTGACGACATGGTTCTTTGTGTTCTGGCCGACGATGCTCTGCGAATACTG
GGCCGCCAAGCAACATGGCGTGAAAAGCTGGTCCTCGGCGGCGCTGCCTTTTACGACGACATCACCGTCACCCAT
ACCGATCGGGCCTACTTCGAAAAGCAGTACGAGACCGTCTTCAAGCCGGAGCTGTGCGCGGAGCCAACGTCAGAT
TTCCAGAAGAAGCAGATTGCCTTTGCCAAAGGCGAAGGGGTTGAAGGCTCGGGCAGCTTCCAGCCCATGTACTAC
ACCTTTTCCTACCAGCAGGACCCGCGCTTGATCGAGATGTCCTTCAACTGCAGCAACTACCAACATCAGCTGAAA
AAGGCTAACCACGACAACAAAGACAGCTTCGAGCCTGTCTACCAAACCATCTTCCTGAACAAGGACCTGAAGCAC
CTGTGGACGATCGACGACATCGATGAGGCAAAGGTCATCAAGAAGAACTGGTGGCATCAGCTCGGTCATCGGTGG
CAGCATTACCTTCGCGTCGTCCCGGGCATGATGTTCATCAATGGGAAGAACCGGACGTGCTTTGCAGGATCCTGG
ACGCTCGTGGTAAGAAGGCTACCCCTCGGATTGGTTTGGAGAGTATCGGCTCAACTCGGGGGTGTAGAACATGCA
CGAACTGGCTTGCGTCAGTGGCATCGCGGCAGCGTACCGCCTCGGAGCTGATTACAAGCGGTTTGACGATTTTGC
GCAAGACTTCTTCGCCAAATATCTCCTGCTGTCTCATGGGATGATGTTTTCCCGGCAGGAGAAGCGGCGGCATTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail