Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2523
Gene name
Locationscaffold_208:17196..19222
Strand-
Gene length (bp)2026
Transcript length (bp)1782
Coding sequence length (bp)1779
Protein length (aa) 593

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 8.7E-14 92 162
PF01266 DAO FAD dependent oxidoreductase 1.5E-07 89 129
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 4.3E-06 88 126
PF00890 FAD_binding_2 FAD binding domain 5.1E-07 90 128
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 9.3E-05 98 139

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 213 232 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2523
MGTTIDHSPWLFPLACALITLIRHPCIPEQIHDVLDWDSSAATPDVMTQREADRPWRQVVFSSHVVRPMPPKHSS
GRDEMAPLNSKAKHVVIIGGGAAGMSCAATLANHPDRYKVTVLEKSDVVGGQATSIPLDEQKYGAPWMNNGVQGG
SQIFKHTFNFFRQQGFPPQEVQLQVAFGKGDAGFWTNVFPSKLVQRYSADVKKFGFFLKLIKWTMPVLGLVPISI
MLRLLFFSKDFGDKMVYPLIALFLGTGNQTPHVPSAIVERLFDDPNMKLWDYDPTTLLPNLPTMFTFDHLHAFYG
AWKSDLEANGVTFRNGTDVSEVISRTKHGVKLRIRDVATGSSTEETFDDMVLCVLADDALRILGRQATWREKLVL
GGAAFYDDITVTHTDRAYFEKQYETVFKPELCAEPTSDFQKKQIAFAKGEGVEGSGSFQPMYYTFSYQQDPRLIE
MSFNCSNYQHQLKKANHDNKDSFEPVYQTIFLNKDLKHLWTIDDIDEAKVIKKNWWHQLGHRWQHYLRVVPGMMF
INGKNRTCFAGSWTLVNMHELACVSGIAAAYRLGADYKRFDDFAQDFFAKYLLLSHGMMFSRQEKRRH
Coding >Ophio5|2523
ATGGGAACGACAATCGACCATTCCCCTTGGTTGTTCCCCTTGGCTTGCGCCCTTATTACATTGATTCGGCACCCT
TGCATACCAGAACAAATCCATGACGTGCTCGACTGGGACAGCTCCGCGGCTACCCCCGACGTCATGACCCAACGC
GAGGCCGACAGACCCTGGCGACAAGTTGTCTTCTCCTCCCACGTCGTACGTCCAATGCCTCCGAAGCACTCTTCT
GGACGTGACGAAATGGCTCCGCTCAACAGCAAGGCCAAGCATGTCGTGATAATCGGTGGAGGGGCCGCAGGCATG
TCTTGCGCTGCCACGTTGGCAAACCATCCCGATCGTTACAAAGTCACGGTGCTGGAGAAAAGCGACGTGGTCGGC
GGCCAGGCCACGTCAATTCCGCTCGATGAGCAAAAGTACGGCGCACCATGGATGAACAACGGCGTCCAGGGCGGA
TCCCAGATATTCAAGCACACCTTCAACTTCTTCCGCCAGCAGGGCTTCCCACCACAGGAAGTTCAGCTGCAGGTG
GCCTTTGGCAAGGGAGATGCCGGCTTCTGGACAAATGTCTTCCCTAGTAAACTCGTCCAACGGTACTCGGCCGAT
GTCAAGAAGTTTGGCTTTTTCCTCAAGCTCATCAAATGGACCATGCCCGTGCTGGGCCTCGTGCCGATATCCATC
ATGCTGCGTCTGCTCTTCTTCAGTAAGGACTTTGGAGATAAGATGGTATATCCTCTTATTGCCCTGTTCCTCGGA
ACCGGCAACCAAACTCCTCACGTCCCCTCGGCCATCGTCGAGCGTCTCTTCGACGACCCCAACATGAAGCTATGG
GATTACGACCCCACCACCCTACTGCCGAACCTGCCTACCATGTTCACCTTTGACCATCTTCACGCCTTCTACGGC
GCCTGGAAGAGTGACTTGGAGGCCAATGGGGTCACCTTCCGGAACGGCACGGATGTATCTGAAGTCATATCGAGG
ACGAAGCACGGGGTCAAGCTCCGAATTAGGGACGTGGCTACAGGCAGCTCTACAGAGGAGACGTTTGACGACATG
GTTCTTTGTGTTCTGGCCGACGATGCTCTGCGAATACTGGGCCGCCAAGCAACATGGCGTGAAAAGCTGGTCCTC
GGCGGCGCTGCCTTTTACGACGACATCACCGTCACCCATACCGATCGGGCCTACTTCGAAAAGCAGTACGAGACC
GTCTTCAAGCCGGAGCTGTGCGCGGAGCCAACGTCAGATTTCCAGAAGAAGCAGATTGCCTTTGCCAAAGGCGAA
GGGGTTGAAGGCTCGGGCAGCTTCCAGCCCATGTACTACACCTTTTCCTACCAGCAGGACCCGCGCTTGATCGAG
ATGTCCTTCAACTGCAGCAACTACCAACATCAGCTGAAAAAGGCTAACCACGACAACAAAGACAGCTTCGAGCCT
GTCTACCAAACCATCTTCCTGAACAAGGACCTGAAGCACCTGTGGACGATCGACGACATCGATGAGGCAAAGGTC
ATCAAGAAGAACTGGTGGCATCAGCTCGGTCATCGGTGGCAGCATTACCTTCGCGTCGTCCCGGGCATGATGTTC
ATCAATGGGAAGAACCGGACGTGCTTTGCAGGATCCTGGACGCTCGTGAACATGCACGAACTGGCTTGCGTCAGT
GGCATCGCGGCAGCGTACCGCCTCGGAGCTGATTACAAGCGGTTTGACGATTTTGCGCAAGACTTCTTCGCCAAA
TATCTCCTGCTGTCTCATGGGATGATGTTTTCCCGGCAGGAGAAGCGGCGGCAT
Transcript >Ophio5|2523
ATGGGAACGACAATCGACCATTCCCCTTGGTTGTTCCCCTTGGCTTGCGCCCTTATTACATTGATTCGGCACCCT
TGCATACCAGAACAAATCCATGACGTGCTCGACTGGGACAGCTCCGCGGCTACCCCCGACGTCATGACCCAACGC
GAGGCCGACAGACCCTGGCGACAAGTTGTCTTCTCCTCCCACGTCGTACGTCCAATGCCTCCGAAGCACTCTTCT
GGACGTGACGAAATGGCTCCGCTCAACAGCAAGGCCAAGCATGTCGTGATAATCGGTGGAGGGGCCGCAGGCATG
TCTTGCGCTGCCACGTTGGCAAACCATCCCGATCGTTACAAAGTCACGGTGCTGGAGAAAAGCGACGTGGTCGGC
GGCCAGGCCACGTCAATTCCGCTCGATGAGCAAAAGTACGGCGCACCATGGATGAACAACGGCGTCCAGGGCGGA
TCCCAGATATTCAAGCACACCTTCAACTTCTTCCGCCAGCAGGGCTTCCCACCACAGGAAGTTCAGCTGCAGGTG
GCCTTTGGCAAGGGAGATGCCGGCTTCTGGACAAATGTCTTCCCTAGTAAACTCGTCCAACGGTACTCGGCCGAT
GTCAAGAAGTTTGGCTTTTTCCTCAAGCTCATCAAATGGACCATGCCCGTGCTGGGCCTCGTGCCGATATCCATC
ATGCTGCGTCTGCTCTTCTTCAGTAAGGACTTTGGAGATAAGATGGTATATCCTCTTATTGCCCTGTTCCTCGGA
ACCGGCAACCAAACTCCTCACGTCCCCTCGGCCATCGTCGAGCGTCTCTTCGACGACCCCAACATGAAGCTATGG
GATTACGACCCCACCACCCTACTGCCGAACCTGCCTACCATGTTCACCTTTGACCATCTTCACGCCTTCTACGGC
GCCTGGAAGAGTGACTTGGAGGCCAATGGGGTCACCTTCCGGAACGGCACGGATGTATCTGAAGTCATATCGAGG
ACGAAGCACGGGGTCAAGCTCCGAATTAGGGACGTGGCTACAGGCAGCTCTACAGAGGAGACGTTTGACGACATG
GTTCTTTGTGTTCTGGCCGACGATGCTCTGCGAATACTGGGCCGCCAAGCAACATGGCGTGAAAAGCTGGTCCTC
GGCGGCGCTGCCTTTTACGACGACATCACCGTCACCCATACCGATCGGGCCTACTTCGAAAAGCAGTACGAGACC
GTCTTCAAGCCGGAGCTGTGCGCGGAGCCAACGTCAGATTTCCAGAAGAAGCAGATTGCCTTTGCCAAAGGCGAA
GGGGTTGAAGGCTCGGGCAGCTTCCAGCCCATGTACTACACCTTTTCCTACCAGCAGGACCCGCGCTTGATCGAG
ATGTCCTTCAACTGCAGCAACTACCAACATCAGCTGAAAAAGGCTAACCACGACAACAAAGACAGCTTCGAGCCT
GTCTACCAAACCATCTTCCTGAACAAGGACCTGAAGCACCTGTGGACGATCGACGACATCGATGAGGCAAAGGTC
ATCAAGAAGAACTGGTGGCATCAGCTCGGTCATCGGTGGCAGCATTACCTTCGCGTCGTCCCGGGCATGATGTTC
ATCAATGGGAAGAACCGGACGTGCTTTGCAGGATCCTGGACGCTCGTGAACATGCACGAACTGGCTTGCGTCAGT
GGCATCGCGGCAGCGTACCGCCTCGGAGCTGATTACAAGCGGTTTGACGATTTTGCGCAAGACTTCTTCGCCAAA
TATCTCCTGCTGTCTCATGGGATGATGTTTTCCCGGCAGGAGAAGCGGCGGCATTGA
Gene >Ophio5|2523
ATGGGAACGACAATCGACCATTCCCCTTGGTTGTTCCCCTTGGCTTGCGCCCTTATTACATTGATTCGGCACCCT
TGCATACCAGAACAAATCCATGACGTGCTCGACTGGGACAGCTCCGCGGCTACCCCCGACGTCATGACCCAACGC
GAGGCCGACAGACCCTGGCGACAAGTTGTCTTCTCCTCCCACGTCGTACGTCGTACGTCGCACAGCGTCCTGCTT
GTGCAAACGCTCGCCGCCTGCAGCAATGCCTCCGAAGCACTCTTCTGGACGTGACGAAATGGCTCCGCTCAACAG
CAAGGCCAAGCATGTCGTGATAATCGGTGGAGGGGCCGCAGGCATGGTAGGTAGGCTCCGGGCAGCAAGACTCTA
TCGACCCCTATCGACCTTATCGCCCTCTCAGGACCGCCGCATTGACCTAACCTATAGTCTTGCGCTGCCACGTTG
GCAAACCATCCCGATCGTTACAAAGTCACGGTGCTGGAGAAAAGCGACGTGGTCGGCGGCCAGGCCACGTCAATT
CCGCTCGATGAGCAAAAGTACGGCGCACCATGGATGAACAACGGCGTCCAGGGCGGATCCCAGGTCAGCCTCGCC
AGGCCCTAACTCACGTCGCCCGGCTGACGAGGCGTACCGCAGATATTCAAGCACACCTTCAACTTCTTCCGCCAG
CAGGGCTTCCCACCACAGGAAGTTCAGCTGCAGGTGGCCTTTGGCAAGGGAGATGCCGGCTTCTGGACAAATGTC
TTCCCTAGTAAACTCGTCCAACGGTACTCGGCCGATGTCAAGAAGTTTGGCTTTTTCCTCAAGCTCATCAAATGG
ACCATGCCCGTGCTGGGCCTCGTGCCGATATCCATCATGCTGCGTCTGCTCTTCTTCAGTAAGGACTTTGGAGAT
AAGATGGTATATCCTCTTATTGCCCTGTTCCTCGGAACCGGCAACCAAACTCCTCACGTCCCCTCGGCCATCGTC
GAGCGTCTCTTCGACGACCCCAACATGAAGCTATGGGATTACGACCCCACCACCCTACTGCCGAACCTGCCTACC
ATGTTCACCTTTGACCATCTTCACGCCTTCTACGGCGCCTGGAAGAGTGACTTGGAGGCCAATGGGGTCACCTTC
CGGAACGGCACGGATGTATCTGAAGTCATATCGAGGACGAAGCACGGGGTCAAGCTCCGAATTAGGGACGTGGCT
ACAGGCAGCTCTACAGAGGAGACGTTTGACGACATGGTTCTTTGTGTTCTGGCCGACGATGCTCTGCGAATACTG
GGCCGCCAAGCAACATGGCGTGAAAAGCTGGTCCTCGGCGGCGCTGCCTTTTACGACGACATCACCGTCACCCAT
ACCGATCGGGCCTACTTCGAAAAGCAGTACGAGACCGTCTTCAAGCCGGAGCTGTGCGCGGAGCCAACGTCAGAT
TTCCAGAAGAAGCAGATTGCCTTTGCCAAAGGCGAAGGGGTTGAAGGCTCGGGCAGCTTCCAGCCCATGTACTAC
ACCTTTTCCTACCAGCAGGACCCGCGCTTGATCGAGATGTCCTTCAACTGCAGCAACTACCAACATCAGCTGAAA
AAGGCTAACCACGACAACAAAGACAGCTTCGAGCCTGTCTACCAAACCATCTTCCTGAACAAGGACCTGAAGCAC
CTGTGGACGATCGACGACATCGATGAGGCAAAGGTCATCAAGAAGAACTGGTGGCATCAGCTCGGTCATCGGTGG
CAGCATTACCTTCGCGTCGTCCCGGGCATGATGTTCATCAATGGGAAGAACCGGACGTGCTTTGCAGGATCCTGG
ACGCTCGTGGTAAGAAGGCTACCCCTCGGATTGGTTTGGAGAGTATCGGCTCAACTCGGGGGTGTAGAACATGCA
CGAACTGGCTTGCGTCAGTGGCATCGCGGCAGCGTACCGCCTCGGAGCTGATTACAAGCGGTTTGACGATTTTGC
GCAAGACTTCTTCGCCAAATATCTCCTGCTGTCTCATGGGATGATGTTTTCCCGGCAGGAGAAGCGGCGGCATTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail