Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2513
Gene name
Locationscaffold_2075:28..340
Strand-
Gene length (bp)312
Transcript length (bp)312
Coding sequence length (bp)309
Protein length (aa) 103

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 277.05 141.00 413.09
CcL In ants, during behavior modification 298.70 131.43 465.98
CcD In ants, recently dead 872.62 460.88 1284.37

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.814280 no
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2513
MLVVSLLSLAAVAVALPGPAATTTTLTTMTSPTESASSTTAPPVISLPSACDYSYCDGSSSWCFYWAGITSYDIS
RGPVPGETRVPLGPCGVTTTASQPTTRT
Coding >Ophio5|2513
ATGCTCGTCGTATCTCTACTCTCGCTCGCCGCCGTCGCCGTCGCTCTTCCCGGCCCGGCGGCCACGACGACGACG
CTGACCACCATGACGTCCCCAACGGAATCAGCATCCTCGACCACGGCGCCGCCCGTTATCAGCCTCCCATCCGCC
TGCGACTACAGCTACTGTGATGGTAGCTCGTCCTGGTGCTTCTACTGGGCCGGCATCACGTCGTACGACATTTCC
CGCGGTCCCGTCCCCGGAGAGACTAGAGTTCCACTCGGCCCTTGTGGCGTCACCACTACCGCCTCTCAGCCGACT
ACTAGGACT
Transcript >Ophio5|2513
ATGCTCGTCGTATCTCTACTCTCGCTCGCCGCCGTCGCCGTCGCTCTTCCCGGCCCGGCGGCCACGACGACGACG
CTGACCACCATGACGTCCCCAACGGAATCAGCATCCTCGACCACGGCGCCGCCCGTTATCAGCCTCCCATCCGCC
TGCGACTACAGCTACTGTGATGGTAGCTCGTCCTGGTGCTTCTACTGGGCCGGCATCACGTCGTACGACATTTCC
CGCGGTCCCGTCCCCGGAGAGACTAGAGTTCCACTCGGCCCTTGTGGCGTCACCACTACCGCCTCTCAGCCGACT
ACTAGGACTTGA
Gene >Ophio5|2513
ATGCTCGTCGTATCTCTACTCTCGCTCGCCGCCGTCGCCGTCGCTCTTCCCGGCCCGGCGGCCACGACGACGACG
CTGACCACCATGACGTCCCCAACGGAATCAGCATCCTCGACCACGGCGCCGCCCGTTATCAGCCTCCCATCCGCC
TGCGACTACAGCTACTGTGATGGTAGCTCGTCCTGGTGCTTCTACTGGGCCGGCATCACGTCGTACGACATTTCC
CGCGGTCCCGTCCCCGGAGAGACTAGAGTTCCACTCGGCCCTTGTGGCGTCACCACTACCGCCTCTCAGCCGACT
ACTAGGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail