Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2506
Gene name
Locationscaffold_207:17977..18757
Strand+
Gene length (bp)780
Transcript length (bp)780
Coding sequence length (bp)777
Protein length (aa) 259

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6247 0.5035 0.0771 0.0787 0.1965 0.0025 0.052 0.1037 0.0711 0.0473

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6110
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3505
Ophiocordyceps australis map64 (Brazil) OphauB2|2559
Ophiocordyceps kimflemingae Ophio5|2506 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3625

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2506
MAGHREHAATSSPPKINNSKNRPPPPTTRERPLSETQCRHMSTRAQAIWRPRPYEDIYTEQAYLTTSLQLLSRRA
HGLIRQHGQAQNEVRDMKPSKPRRRLRKKLKNLSNELEVLAEQERAVFLRLSDLYMESRCRHAWSVAGQQGVCGE
SSPQPVPRLDDSSPGTLPATAEPLLSVDATPRDGAALEAPVFAGPELESASEDSERTASDDELHLRHQTAKLEEE
EDWWPNETRKSWPEMRVGRNNRMSLPNLEVKWPD
Coding >Ophio5|2506
ATGGCAGGTCATCGAGAGCATGCTGCGACATCATCGCCTCCCAAGATTAACAACTCCAAGAACCGACCGCCGCCG
CCGACGACCAGGGAACGGCCCCTTAGCGAGACACAATGTCGGCACATGAGCACCAGGGCCCAAGCTATCTGGCGA
CCGCGTCCGTACGAGGATATTTATACCGAGCAGGCCTACCTCACCACCTCACTCCAGCTGCTGTCTCGGCGGGCA
CACGGGCTGATCAGACAGCACGGCCAGGCGCAAAACGAGGTCCGGGACATGAAGCCGAGTAAGCCGAGACGTAGG
CTGCGCAAAAAGCTCAAAAATCTGAGCAACGAGCTTGAAGTCCTAGCCGAGCAGGAGAGAGCCGTCTTCCTCCGG
CTAAGCGACCTGTACATGGAGTCTCGCTGTCGCCACGCGTGGTCGGTGGCCGGGCAGCAAGGCGTGTGTGGCGAG
TCCTCGCCACAGCCCGTGCCTCGATTAGACGATTCGTCGCCAGGAACTCTCCCGGCGACTGCGGAGCCCTTGCTG
AGCGTCGACGCCACGCCGAGAGATGGTGCAGCGTTGGAGGCTCCAGTCTTCGCTGGGCCGGAACTGGAGTCAGCG
AGCGAAGACAGCGAGCGGACTGCAAGTGACGATGAGCTACATCTCCGGCACCAGACAGCCAAGTTGGAGGAGGAA
GAAGATTGGTGGCCCAACGAGACGCGCAAATCATGGCCGGAGATGCGCGTGGGCAGGAATAATCGCATGAGTCTA
CCGAATCTGGAGGTGAAATGGCCGGAT
Transcript >Ophio5|2506
ATGGCAGGTCATCGAGAGCATGCTGCGACATCATCGCCTCCCAAGATTAACAACTCCAAGAACCGACCGCCGCCG
CCGACGACCAGGGAACGGCCCCTTAGCGAGACACAATGTCGGCACATGAGCACCAGGGCCCAAGCTATCTGGCGA
CCGCGTCCGTACGAGGATATTTATACCGAGCAGGCCTACCTCACCACCTCACTCCAGCTGCTGTCTCGGCGGGCA
CACGGGCTGATCAGACAGCACGGCCAGGCGCAAAACGAGGTCCGGGACATGAAGCCGAGTAAGCCGAGACGTAGG
CTGCGCAAAAAGCTCAAAAATCTGAGCAACGAGCTTGAAGTCCTAGCCGAGCAGGAGAGAGCCGTCTTCCTCCGG
CTAAGCGACCTGTACATGGAGTCTCGCTGTCGCCACGCGTGGTCGGTGGCCGGGCAGCAAGGCGTGTGTGGCGAG
TCCTCGCCACAGCCCGTGCCTCGATTAGACGATTCGTCGCCAGGAACTCTCCCGGCGACTGCGGAGCCCTTGCTG
AGCGTCGACGCCACGCCGAGAGATGGTGCAGCGTTGGAGGCTCCAGTCTTCGCTGGGCCGGAACTGGAGTCAGCG
AGCGAAGACAGCGAGCGGACTGCAAGTGACGATGAGCTACATCTCCGGCACCAGACAGCCAAGTTGGAGGAGGAA
GAAGATTGGTGGCCCAACGAGACGCGCAAATCATGGCCGGAGATGCGCGTGGGCAGGAATAATCGCATGAGTCTA
CCGAATCTGGAGGTGAAATGGCCGGATTGA
Gene >Ophio5|2506
ATGGCAGGTCATCGAGAGCATGCTGCGACATCATCGCCTCCCAAGATTAACAACTCCAAGAACCGACCGCCGCCG
CCGACGACCAGGGAACGGCCCCTTAGCGAGACACAATGTCGGCACATGAGCACCAGGGCCCAAGCTATCTGGCGA
CCGCGTCCGTACGAGGATATTTATACCGAGCAGGCCTACCTCACCACCTCACTCCAGCTGCTGTCTCGGCGGGCA
CACGGGCTGATCAGACAGCACGGCCAGGCGCAAAACGAGGTCCGGGACATGAAGCCGAGTAAGCCGAGACGTAGG
CTGCGCAAAAAGCTCAAAAATCTGAGCAACGAGCTTGAAGTCCTAGCCGAGCAGGAGAGAGCCGTCTTCCTCCGG
CTAAGCGACCTGTACATGGAGTCTCGCTGTCGCCACGCGTGGTCGGTGGCCGGGCAGCAAGGCGTGTGTGGCGAG
TCCTCGCCACAGCCCGTGCCTCGATTAGACGATTCGTCGCCAGGAACTCTCCCGGCGACTGCGGAGCCCTTGCTG
AGCGTCGACGCCACGCCGAGAGATGGTGCAGCGTTGGAGGCTCCAGTCTTCGCTGGGCCGGAACTGGAGTCAGCG
AGCGAAGACAGCGAGCGGACTGCAAGTGACGATGAGCTACATCTCCGGCACCAGACAGCCAAGTTGGAGGAGGAA
GAAGATTGGTGGCCCAACGAGACGCGCAAATCATGGCCGGAGATGCGCGTGGGCAGGAATAATCGCATGAGTCTA
CCGAATCTGGAGGTGAAATGGCCGGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail