Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2500
Gene name
Locationscaffold_206:26002..31228
Strand+
Gene length (bp)5226
Transcript length (bp)5226
Coding sequence length (bp)5223
Protein length (aa) 1741

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 3.5E-19 528 659
PF00005 ABC_tran ABC transporter 2.4E-26 1298 1441
PF12698 ABC2_membrane_3 ABC-2 family transporter protein 6.1E-11 228 458
PF12698 ABC2_membrane_3 ABC-2 family transporter protein 6.0E-14 989 1238
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 1.1E-06 1411 1473

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 525 1503 4.0E-103
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 321 1503 2.0E-95
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 525 1523 8.0E-93
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 258 1602 4.0E-87
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 307 1602 8.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 525 1503 4.0E-103
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 321 1503 2.0E-95
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 525 1523 8.0E-93
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 258 1602 4.0E-87
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 307 1602 8.0E-87
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 525 1510 1.0E-85
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 526 1540 9.0E-81
sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 251 1503 8.0E-79
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 338 1130 3.0E-54
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 1035 1522 4.0E-54
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 1035 1552 9.0E-54
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 1028 1560 1.0E-52
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 1028 1560 2.0E-52
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 1028 1560 6.0E-52
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 152 868 2.0E-50
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 258 817 6.0E-50
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 1035 1552 3.0E-49
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 1026 1558 3.0E-49
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 1035 1552 6.0E-49
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 488 822 2.0E-48
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 1035 1711 2.0E-48
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 488 822 6.0E-47
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 1026 1567 6.0E-47
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 525 822 9.0E-47
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 1026 1542 1.0E-46
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 1275 1552 4.0E-46
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 348 864 1.0E-45
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 331 726 5.0E-45
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 331 796 2.0E-43
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 481 789 2.0E-43
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 331 726 3.0E-43
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 319 796 5.0E-43
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 304 812 9.0E-43
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 1283 1560 1.0E-42
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 1033 1510 2.0E-42
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 526 808 2.0E-42
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 331 796 5.0E-42
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 481 797 9.0E-42
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 993 1503 2.0E-41
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 993 1602 3.0E-41
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 311 725 4.0E-41
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 304 797 5.0E-41
sp|Q9FLT5|AB9A_ARATH ABC transporter A family member 9 OS=Arabidopsis thaliana GN=ABCA9 PE=1 SV=1 484 796 7.0E-41
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 968 1560 7.0E-41
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 339 796 8.0E-41
sp|Q84K47|AB2A_ARATH ABC transporter A family member 2 OS=Arabidopsis thaliana GN=ABCA2 PE=2 SV=1 484 796 1.0E-40
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 314 813 3.0E-40
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 311 726 1.0E-39
sp|Q9FKF2|AB11A_ARATH ABC transporter A family member 11 OS=Arabidopsis thaliana GN=ABCA11 PE=3 SV=1 485 796 3.0E-39
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 331 789 6.0E-39
sp|Q54DT1|ABCA9_DICDI ABC transporter A family member 9 OS=Dictyostelium discoideum GN=abcA9 PE=3 SV=1 523 789 7.0E-39
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 309 816 8.0E-39
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 1055 1503 1.0E-38
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 482 800 2.0E-37
sp|Q8T6J0|ABCA7_DICDI ABC transporter A family member 7 OS=Dictyostelium discoideum GN=abcA7 PE=3 SV=1 523 789 2.0E-37
sp|Q9STT7|AB5A_ARATH ABC transporter A family member 5 OS=Arabidopsis thaliana GN=ABCA5 PE=3 SV=2 1294 1557 3.0E-37
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 1282 1540 4.0E-37
sp|Q8LPK0|AB8A_ARATH ABC transporter A family member 8 OS=Arabidopsis thaliana GN=ABCA8 PE=2 SV=3 487 791 5.0E-37
sp|Q1PEH6|AB3A_ARATH ABC transporter A family member 3 OS=Arabidopsis thaliana GN=ABCA3 PE=2 SV=3 1297 1503 5.0E-37
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 1279 1517 8.0E-37
sp|Q9FLT5|AB9A_ARATH ABC transporter A family member 9 OS=Arabidopsis thaliana GN=ABCA9 PE=1 SV=1 1297 1503 1.0E-36
sp|Q9STT6|AB6A_ARATH ABC transporter A family member 6 OS=Arabidopsis thaliana GN=ABCA6 PE=3 SV=2 1267 1568 1.0E-36
sp|Q9STT8|AB4A_ARATH ABC transporter A family member 4 OS=Arabidopsis thaliana GN=ABCA4 PE=3 SV=2 1297 1560 1.0E-36
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 525 796 2.0E-36
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 1279 1543 2.0E-36
sp|Q9FKF2|AB11A_ARATH ABC transporter A family member 11 OS=Arabidopsis thaliana GN=ABCA11 PE=3 SV=1 1297 1503 2.0E-36
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 1236 1503 3.0E-36
sp|Q9STT5|AB7A_ARATH ABC transporter A family member 7 OS=Arabidopsis thaliana GN=ABCA7 PE=3 SV=2 489 790 3.0E-36
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 1297 1543 3.0E-36
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 1282 1540 4.0E-36
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 482 805 4.0E-36
sp|Q9STT5|AB7A_ARATH ABC transporter A family member 7 OS=Arabidopsis thaliana GN=ABCA7 PE=3 SV=2 1244 1557 5.0E-36
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 1279 1543 7.0E-36
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 489 789 8.0E-36
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 525 795 2.0E-35
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 1279 1543 2.0E-35
sp|Q9STT6|AB6A_ARATH ABC transporter A family member 6 OS=Arabidopsis thaliana GN=ABCA6 PE=3 SV=2 517 791 2.0E-35
sp|Q9FLT4|AB10A_ARATH ABC transporter A family member 10 OS=Arabidopsis thaliana GN=ABCA10 PE=1 SV=2 489 743 2.0E-35
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 1035 1511 3.0E-35
sp|Q9STT7|AB5A_ARATH ABC transporter A family member 5 OS=Arabidopsis thaliana GN=ABCA5 PE=3 SV=2 525 798 3.0E-35
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 525 796 4.0E-35
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 1042 1540 4.0E-35
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 1259 1552 6.0E-35
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 1294 1557 6.0E-35
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 1283 1525 7.0E-35
sp|Q84K47|AB2A_ARATH ABC transporter A family member 2 OS=Arabidopsis thaliana GN=ABCA2 PE=2 SV=1 1297 1503 8.0E-35
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 1035 1511 9.0E-35
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 525 794 9.0E-35
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 1279 1542 9.0E-35
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 1282 1511 1.0E-34
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 1282 1564 1.0E-34
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 1283 1503 1.0E-34
sp|Q1PEH6|AB3A_ARATH ABC transporter A family member 3 OS=Arabidopsis thaliana GN=ABCA3 PE=2 SV=3 517 789 1.0E-34
sp|Q9STT8|AB4A_ARATH ABC transporter A family member 4 OS=Arabidopsis thaliana GN=ABCA4 PE=3 SV=2 489 726 1.0E-34
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 525 795 1.0E-34
sp|Q54R52|ABCAA_DICDI ABC transporter A family member 10 OS=Dictyostelium discoideum GN=abcA10 PE=3 SV=1 485 730 2.0E-34
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 1283 1498 2.0E-34
sp|Q8LPK0|AB8A_ARATH ABC transporter A family member 8 OS=Arabidopsis thaliana GN=ABCA8 PE=2 SV=3 1280 1503 3.0E-34
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 1232 1539 4.0E-34
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 1282 1511 5.0E-34
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 1282 1519 5.0E-34
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 1294 1557 5.0E-34
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 1290 1485 7.0E-34
sp|Q9FLT4|AB10A_ARATH ABC transporter A family member 10 OS=Arabidopsis thaliana GN=ABCA10 PE=1 SV=2 1297 1560 8.0E-34
sp|P55476|NODI_RHISN Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain NGR234) GN=nodI PE=3 SV=1 1280 1485 8.0E-34
sp|Q8GNH6|NODI_RHIML Nod factor export ATP-binding protein I OS=Rhizobium meliloti GN=nodI PE=3 SV=1 1285 1493 9.0E-34
sp|Q54DT1|ABCA9_DICDI ABC transporter A family member 9 OS=Dictyostelium discoideum GN=abcA9 PE=3 SV=1 1285 1572 2.0E-33
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 1294 1557 4.0E-33
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 1297 1557 4.0E-33
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 1285 1485 4.0E-33
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 1283 1540 4.0E-33
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 1294 1557 5.0E-33
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 1287 1494 5.0E-33
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 514 789 6.0E-33
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 525 795 9.0E-33
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 1060 1539 1.0E-32
sp|Q8T6J0|ABCA7_DICDI ABC transporter A family member 7 OS=Dictyostelium discoideum GN=abcA7 PE=3 SV=1 1283 1546 1.0E-32
sp|P23703|NODI_RHILO Nod factor export ATP-binding protein I OS=Rhizobium loti (strain MAFF303099) GN=nodI PE=3 SV=2 1286 1487 1.0E-32
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 1283 1537 2.0E-32
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 525 792 2.0E-32
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 254 792 2.0E-32
sp|Q1M7W6|NODI_RHIL3 Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nodI PE=3 SV=2 1285 1493 2.0E-32
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 1287 1494 2.0E-32
sp|P72335|NODI_RHIS3 Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain N33) GN=nodI PE=3 SV=1 1285 1494 2.0E-32
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 1287 1494 2.0E-32
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 1287 1494 2.0E-32
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 1287 1494 3.0E-32
sp|P08720|NODI_RHILV Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae GN=nodI PE=3 SV=1 1285 1493 3.0E-32
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 1294 1504 6.0E-32
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 1287 1494 6.0E-32
sp|Q9Z3I3|NODI_BRASS Nod factor export ATP-binding protein I OS=Bradyrhizobium sp. (strain SNU001) GN=nodI PE=3 SV=1 1285 1479 7.0E-32
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 482 806 9.0E-32
sp|Q54R52|ABCAA_DICDI ABC transporter A family member 10 OS=Dictyostelium discoideum GN=abcA10 PE=3 SV=1 1273 1501 9.0E-32
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 1283 1498 1.0E-31
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 1287 1494 2.0E-31
sp|Q552P3|ABCAB_DICDI ABC transporter A family member 11 OS=Dictyostelium discoideum GN=abcA11 PE=3 SV=1 474 800 2.0E-31
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 1283 1504 3.0E-31
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 523 787 3.0E-31
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 1273 1543 4.0E-31
sp|Q552P3|ABCAB_DICDI ABC transporter A family member 11 OS=Dictyostelium discoideum GN=abcA11 PE=3 SV=1 1289 1537 4.0E-31
sp|Q8KLG1|NODI_RHIEC Nod factor export ATP-binding protein I OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nodI PE=3 SV=3 1286 1485 4.0E-31
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 1297 1520 7.0E-31
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 1294 1545 7.0E-31
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 1282 1514 2.0E-30
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 1223 1514 2.0E-30
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 521 789 2.0E-30
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 1054 1490 3.0E-30
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 517 742 3.0E-30
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 1281 1501 3.0E-30
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 1054 1490 6.0E-30
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 1054 1522 8.0E-30
sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 510 789 9.0E-30
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 485 804 1.0E-29
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 485 792 2.0E-29
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 522 730 3.0E-29
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 1288 1493 3.0E-29
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 1282 1514 4.0E-29
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 1271 1503 2.0E-28
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 526 801 2.0E-28
sp|Q46YX6|NODI_CUPPJ Nod factor export ATP-binding protein I OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nodI PE=3 SV=1 1283 1479 3.0E-28
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 1279 1504 3.0E-28
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 1279 1504 3.0E-28
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 485 792 4.0E-28
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 526 792 5.0E-28
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 526 808 7.0E-28
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 522 807 7.0E-28
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 512 806 9.0E-28
sp|P72335|NODI_RHIS3 Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain N33) GN=nodI PE=3 SV=1 525 789 1.0E-27
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 526 796 2.0E-27
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 526 796 8.0E-27
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 469 789 2.0E-26
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 1283 1506 2.0E-26
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 1282 1487 2.0E-26
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 1282 1487 2.0E-26
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 485 811 3.0E-26
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 525 789 3.0E-26
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 490 792 1.0E-25
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 1283 1506 1.0E-25
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 523 799 2.0E-25
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 526 792 2.0E-25
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 525 789 2.0E-25
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 1283 1506 2.0E-25
sp|Q8GNH6|NODI_RHIML Nod factor export ATP-binding protein I OS=Rhizobium meliloti GN=nodI PE=3 SV=1 518 789 4.0E-25
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 527 790 5.0E-25
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 480 730 6.0E-25
sp|P32010|DRRA_STRPE Daunorubicin/doxorubicin resistance ATP-binding protein DrrA OS=Streptomyces peucetius GN=drrA PE=1 SV=1 526 723 7.0E-25
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 1283 1498 8.0E-25
sp|Q8U3E0|Y528_PYRFU Putative ABC transporter ATP-binding protein PF0528 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0528 PE=3 SV=1 1285 1473 1.0E-24
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 527 724 2.0E-24
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 525 789 2.0E-24
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 1283 1485 2.0E-24
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 1283 1498 2.0E-24
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 1283 1532 4.0E-24
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 518 789 6.0E-24
sp|P23703|NODI_RHILO Nod factor export ATP-binding protein I OS=Rhizobium loti (strain MAFF303099) GN=nodI PE=3 SV=2 525 789 6.0E-24
sp|Q8KLG1|NODI_RHIEC Nod factor export ATP-binding protein I OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nodI PE=3 SV=3 527 789 6.0E-24
sp|P9WQL9|DRRA_MYCTU Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=drrA PE=1 SV=1 1280 1503 7.0E-24
sp|P9WQL8|DRRA_MYCTO Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=drrA PE=3 SV=1 1280 1503 7.0E-24
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 1282 1487 7.0E-24
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 1282 1475 1.0E-23
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 1283 1501 1.0E-23
sp|Q110U3|POTA_TRIEI Spermidine/putrescine import ATP-binding protein PotA OS=Trichodesmium erythraeum (strain IMS101) GN=potA PE=3 SV=1 1290 1498 2.0E-23
sp|Q98K23|CYSA_RHILO Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhizobium loti (strain MAFF303099) GN=cysA PE=3 SV=1 1283 1498 2.0E-23
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 1280 1487 2.0E-23
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 525 789 3.0E-23
sp|P32010|DRRA_STRPE Daunorubicin/doxorubicin resistance ATP-binding protein DrrA OS=Streptomyces peucetius GN=drrA PE=1 SV=1 1283 1524 4.0E-23
sp|Q92XW1|CYSA1_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Rhizobium meliloti (strain 1021) GN=cysA1 PE=3 SV=1 1283 1498 4.0E-23
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 525 789 5.0E-23
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 1285 1498 5.0E-23
sp|P36879|YADG_ECOLI Uncharacterized ABC transporter ATP-binding protein YadG OS=Escherichia coli (strain K12) GN=yadG PE=3 SV=1 1282 1485 6.0E-23
sp|P63354|CYSA_BRUSU Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella suis biovar 1 (strain 1330) GN=cysA PE=3 SV=1 1283 1498 8.0E-23
sp|P63353|CYSA_BRUME Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=cysA PE=3 SV=1 1283 1498 8.0E-23
sp|P54592|YHCH_BACSU Uncharacterized ABC transporter ATP-binding protein YhcH OS=Bacillus subtilis (strain 168) GN=yhcH PE=3 SV=1 1283 1490 8.0E-23
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 1283 1485 9.0E-23
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 525 789 1.0E-22
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 525 789 1.0E-22
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 1287 1503 1.0E-22
sp|Q1AS06|POTA_RUBXD Spermidine/putrescine import ATP-binding protein PotA OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=potA PE=3 SV=1 1277 1485 1.0E-22
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 1283 1479 1.0E-22
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 525 789 2.0E-22
sp|Q9Z3I3|NODI_BRASS Nod factor export ATP-binding protein I OS=Bradyrhizobium sp. (strain SNU001) GN=nodI PE=3 SV=1 525 789 2.0E-22
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 1282 1498 3.0E-22
sp|O31427|SKFE_BACSU SkfA peptide export ATP-binding protein SkfE OS=Bacillus subtilis (strain 168) GN=skfE PE=1 SV=1 1283 1487 3.0E-22
sp|Q67SV5|METN_SYMTH Methionine import ATP-binding protein MetN OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metN PE=3 SV=1 490 727 3.0E-22
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 1282 1485 4.0E-22
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 1282 1485 4.0E-22
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 527 789 5.0E-22
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 527 789 5.0E-22
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 1293 1485 5.0E-22
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 1285 1498 6.0E-22
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 1282 1512 7.0E-22
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 1282 1512 7.0E-22
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 1285 1500 8.0E-22
sp|P36879|YADG_ECOLI Uncharacterized ABC transporter ATP-binding protein YadG OS=Escherichia coli (strain K12) GN=yadG PE=3 SV=1 524 709 9.0E-22
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 1283 1498 9.0E-22
sp|P55476|NODI_RHISN Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain NGR234) GN=nodI PE=3 SV=1 518 789 1.0E-21
sp|Q1M7W6|NODI_RHIL3 Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nodI PE=3 SV=2 518 789 1.0E-21
sp|Q5YZY9|CYSA_NOCFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1 1283 1501 1.0E-21
sp|P9WQL6|FLQE1_MYCTO Fluoroquinolones export ATP-binding protein MT2762 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2762 PE=3 SV=1 1279 1499 1.0E-21
sp|Q28K97|TAUB_JANSC Taurine import ATP-binding protein TauB OS=Jannaschia sp. (strain CCS1) GN=tauB PE=3 SV=1 1282 1488 1.0E-21
sp|Q0SRL2|POTA_CLOPS Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain SM101 / Type A) GN=potA PE=3 SV=2 1283 1475 1.0E-21
sp|P08720|NODI_RHILV Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae GN=nodI PE=3 SV=1 518 789 2.0E-21
sp|P31134|POTG_ECOLI Putrescine transport ATP-binding protein PotG OS=Escherichia coli (strain K12) GN=potG PE=3 SV=2 1283 1498 2.0E-21
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 1278 1487 2.0E-21
sp|Q65UE1|POTA_MANSM Spermidine/putrescine import ATP-binding protein PotA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=potA PE=3 SV=1 1283 1487 2.0E-21
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 1282 1488 2.0E-21
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 1285 1494 3.0E-21
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 1285 1494 3.0E-21
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 1285 1494 3.0E-21
sp|P9WQL7|FLQE1_MYCTU Fluoroquinolones export ATP-binding protein Rv2688c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2688c PE=1 SV=1 1279 1499 3.0E-21
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 1283 1494 3.0E-21
sp|Q3MAR5|POTA_ANAVT Spermidine/putrescine import ATP-binding protein PotA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=potA PE=3 SV=1 1287 1501 3.0E-21
sp|Q8XIZ5|POTA_CLOPE Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain 13 / Type A) GN=potA PE=3 SV=1 1283 1475 3.0E-21
sp|Q0TNZ3|POTA_CLOP1 Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=potA PE=3 SV=1 1283 1475 3.0E-21
sp|P44531|FBPC1_HAEIN Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1 1278 1487 3.0E-21
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 1282 1485 3.0E-21
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 526 722 4.0E-21
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 1283 1485 4.0E-21
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 1283 1485 4.0E-21
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 1276 1479 4.0E-21
sp|Q02R79|POTA_PSEAB Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=potA PE=3 SV=1 1283 1485 4.0E-21
sp|Q3JKX3|TAUB_BURP1 Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain 1710b) GN=tauB PE=3 SV=1 1293 1502 4.0E-21
sp|Q62AW4|TAUB_BURMA Taurine import ATP-binding protein TauB OS=Burkholderia mallei (strain ATCC 23344) GN=tauB PE=3 SV=1 1293 1502 4.0E-21
sp|Q9HY19|POTA2_PSEAE Spermidine/putrescine import ATP-binding protein PotA 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA2 PE=3 SV=1 1283 1485 4.0E-21
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 1283 1481 4.0E-21
sp|P42332|BCRA_BACLI Bacitracin transport ATP-binding protein BcrA OS=Bacillus licheniformis GN=bcrA PE=3 SV=1 1283 1510 5.0E-21
sp|C0SPB4|YHAQ_BACSU Uncharacterized ABC transporter ATP-binding protein YhaQ OS=Bacillus subtilis (strain 168) GN=yhaQ PE=3 SV=1 526 793 6.0E-21
sp|Q8YM92|POTA_NOSS1 Spermidine/putrescine import ATP-binding protein PotA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=potA PE=3 SV=1 1287 1501 6.0E-21
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 1279 1500 6.0E-21
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 1284 1501 8.0E-21
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 1283 1498 9.0E-21
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 1282 1487 9.0E-21
sp|P9WQL9|DRRA_MYCTU Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=drrA PE=1 SV=1 487 792 1.0E-20
sp|P9WQL8|DRRA_MYCTO Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=drrA PE=3 SV=1 487 792 1.0E-20
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 1275 1498 1.0E-20
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 1283 1475 1.0E-20
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 1283 1481 1.0E-20
sp|Q63JZ3|TAUB_BURPS Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain K96243) GN=tauB PE=3 SV=1 1293 1531 2.0E-20
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 1283 1487 2.0E-20
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 1283 1487 2.0E-20
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 1283 1506 2.0E-20
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 1283 1487 2.0E-20
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 1281 1498 2.0E-20
sp|Q9A7X1|CYSA_CAUCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cysA PE=3 SV=2 1285 1498 2.0E-20
sp|Q97KS6|POTA_CLOAB Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=potA PE=3 SV=1 1283 1475 2.0E-20
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 1283 1487 2.0E-20
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 1283 1487 2.0E-20
sp|O85818|POTA_AGGAC Spermidine/putrescine import ATP-binding protein PotA OS=Aggregatibacter actinomycetemcomitans GN=potA PE=3 SV=1 1283 1491 2.0E-20
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 1283 1506 3.0E-20
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 1283 1487 3.0E-20
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 1283 1490 3.0E-20
sp|Q0AGF4|POTA_NITEC Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas eutropha (strain C91) GN=potA PE=3 SV=1 1283 1498 4.0E-20
sp|Q92DL6|POTA_LISIN Spermidine/putrescine import ATP-binding protein PotA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=potA PE=3 SV=2 1283 1487 4.0E-20
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 1283 1498 4.0E-20
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 1285 1475 4.0E-20
sp|Q57855|Y412_METJA Uncharacterized ABC transporter ATP-binding protein MJ0412 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0412 PE=3 SV=1 1283 1488 5.0E-20
sp|A0AGP9|POTA_LISW6 Spermidine/putrescine import ATP-binding protein PotA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=potA PE=3 SV=1 1283 1487 6.0E-20
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 526 721 7.0E-20
sp|Q2YAD6|POTA_NITMU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=potA PE=3 SV=1 1283 1487 7.0E-20
sp|Q58429|Y1023_METJA Uncharacterized ABC transporter ATP-binding protein MJ1023 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1023 PE=3 SV=1 1283 1504 8.0E-20
sp|Q8Y8T6|POTA_LISMO Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=potA PE=3 SV=2 1283 1487 8.0E-20
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 1283 1487 1.0E-19
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 1283 1487 1.0E-19
sp|Q8EPK1|METN1_OCEIH Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2 1294 1485 1.0E-19
sp|Q7NWX3|CYSA2_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA2 PE=3 SV=1 1281 1511 1.0E-19
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 524 718 1.0E-19
sp|Q30V33|POTA_DESAG Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio alaskensis (strain G20) GN=potA PE=3 SV=1 1288 1498 1.0E-19
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 1279 1479 1.0E-19
sp|Q722B1|POTA_LISMF Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=potA PE=3 SV=2 1283 1487 1.0E-19
sp|Q82TL6|POTA_NITEU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=potA PE=3 SV=1 1283 1485 1.0E-19
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 1283 1481 1.0E-19
sp|Q9K789|METN_BACHD Methionine import ATP-binding protein MetN OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metN PE=3 SV=1 1293 1519 1.0E-19
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 1279 1510 2.0E-19
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 526 724 2.0E-19
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 526 724 2.0E-19
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 520 718 2.0E-19
sp|Q0TA26|MALK_ECOL5 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=malK PE=3 SV=1 1283 1535 2.0E-19
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 520 714 2.0E-19
sp|Q2T751|TAUB_BURTA Taurine import ATP-binding protein TauB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tauB PE=3 SV=1 1293 1531 2.0E-19
sp|Q1B677|METN_MYCSS Methionine import ATP-binding protein MetN OS=Mycobacterium sp. (strain MCS) GN=metN PE=3 SV=2 1283 1473 2.0E-19
sp|O34977|YTHP_BACSU Uncharacterized ABC transporter ATP-binding protein YthP OS=Bacillus subtilis (strain 168) GN=ythP PE=3 SV=1 532 723 2.0E-19
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 1283 1498 2.0E-19
sp|Q89UD2|CYSA_BRADU Sulfate/thiosulfate import ATP-binding protein CysA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cysA PE=3 SV=1 1283 1498 2.0E-19
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 1283 1535 2.0E-19
sp|A1TXH7|POTA_MARHV Spermidine/putrescine import ATP-binding protein PotA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=potA PE=3 SV=1 1283 1514 2.0E-19
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 1283 1491 2.0E-19
sp|P38046|NRTD_SYNE7 Nitrate transport ATP-binding protein NrtD OS=Synechococcus elongatus (strain PCC 7942) GN=nrtD PE=3 SV=1 502 718 2.0E-19
sp|Q72FW5|POTA_DESVH Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=potA PE=3 SV=1 1280 1498 2.0E-19
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 1283 1514 2.0E-19
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 1283 1535 2.0E-19
sp|Q46YX6|NODI_CUPPJ Nod factor export ATP-binding protein I OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nodI PE=3 SV=1 525 789 3.0E-19
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 1283 1535 3.0E-19
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 1283 1535 3.0E-19
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 1283 1535 3.0E-19
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 1283 1535 3.0E-19
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 1283 1535 3.0E-19
sp|Q32JQ8|METN_SHIDS Methionine import ATP-binding protein MetN OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metN PE=3 SV=1 490 709 3.0E-19
sp|P55604|Y4OS_RHISN Uncharacterized ABC transporter ATP-binding protein y4oS OS=Rhizobium sp. (strain NGR234) GN=NGR_a02170 PE=3 SV=1 1285 1524 3.0E-19
sp|Q4FMG5|TAUB_PELUB Taurine import ATP-binding protein TauB OS=Pelagibacter ubique (strain HTCC1062) GN=tauB PE=3 SV=1 1297 1488 3.0E-19
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 1283 1491 4.0E-19
sp|Q0TLD2|METN_ECOL5 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metN PE=3 SV=1 490 709 4.0E-19
sp|Q98QH5|ECFA1_MYCPU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ecfA1 PE=3 SV=1 526 718 4.0E-19
sp|P30750|METN_ECOLI Methionine import ATP-binding protein MetN OS=Escherichia coli (strain K12) GN=metN PE=1 SV=4 490 709 4.0E-19
sp|Q3Z5F8|METN_SHISS Methionine import ATP-binding protein MetN OS=Shigella sonnei (strain Ss046) GN=metN PE=3 SV=1 490 709 4.0E-19
sp|Q1RFY9|METN_ECOUT Methionine import ATP-binding protein MetN OS=Escherichia coli (strain UTI89 / UPEC) GN=metN PE=3 SV=1 490 709 4.0E-19
sp|P63355|METN_ECOL6 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metN PE=3 SV=1 490 709 4.0E-19
sp|P63356|METN_ECO57 Methionine import ATP-binding protein MetN OS=Escherichia coli O157:H7 GN=metN PE=3 SV=1 490 709 4.0E-19
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 1308 1476 5.0E-19
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 1308 1476 5.0E-19
sp|P54591|YHCG_BACSU Uncharacterized ABC transporter ATP-binding protein YhcG OS=Bacillus subtilis (strain 168) GN=yhcG PE=3 SV=1 1283 1503 5.0E-19
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 1283 1487 5.0E-19
sp|A1B9H9|SSUB1_PARDP Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=ssuB1 PE=3 SV=1 527 709 5.0E-19
sp|Q325U1|METN_SHIBS Methionine import ATP-binding protein MetN OS=Shigella boydii serotype 4 (strain Sb227) GN=metN PE=3 SV=1 490 709 5.0E-19
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 1283 1501 5.0E-19
sp|A1TAI4|POTA_MYCVP Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=potA PE=3 SV=1 1283 1501 6.0E-19
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 1288 1531 6.0E-19
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 1283 1498 6.0E-19
sp|Q9MUN1|CYSA_MESVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Mesostigma viride GN=cysA PE=3 SV=1 1285 1479 6.0E-19
sp|Q8U4K3|WTPC_PYRFU Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1 1283 1501 7.0E-19
sp|Q58429|Y1023_METJA Uncharacterized ABC transporter ATP-binding protein MJ1023 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1023 PE=3 SV=1 537 707 8.0E-19
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 1282 1476 8.0E-19
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 1283 1485 8.0E-19
sp|Q07756|NODI_AZOC5 Nod factor export ATP-binding protein I OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodI PE=3 SV=1 1305 1486 8.0E-19
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 1283 1485 8.0E-19
sp|Q88ZJ6|POTA_LACPL Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=potA PE=3 SV=1 1283 1479 9.0E-19
sp|Q7MKU3|POTA_VIBVY Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain YJ016) GN=potA PE=3 SV=2 1278 1481 9.0E-19
sp|Q8D9J4|POTA_VIBVU Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain CMCP6) GN=potA PE=3 SV=1 1278 1481 9.0E-19
sp|Q6ME20|METN_PARUW Methionine import ATP-binding protein MetN OS=Protochlamydia amoebophila (strain UWE25) GN=metN PE=3 SV=1 1283 1486 1.0E-18
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 1283 1485 1.0E-18
sp|Q8ZPK4|OSMV_SALTY Osmoprotectant import ATP-binding protein OsmV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=osmV PE=1 SV=1 522 718 1.0E-18
sp|P19844|NOSF_PSEST Copper transport ATP-binding protein NosF OS=Pseudomonas stutzeri GN=nosF PE=3 SV=1 1283 1503 1.0E-18
sp|Q14Q07|POTA_SPICI Spermidine/putrescine import ATP-binding protein PotA OS=Spiroplasma citri GN=potA PE=3 SV=1 1283 1481 1.0E-18
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 1283 1485 1.0E-18
sp|P42246|YCBN_BACSU Uncharacterized ABC transporter ATP-binding protein YcbN OS=Bacillus subtilis (strain 168) GN=ycbN PE=3 SV=4 1288 1499 1.0E-18
sp|Q667L9|METN2_YERPS Methionine import ATP-binding protein MetN 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN2 PE=3 SV=1 519 718 1.0E-18
sp|C0SPB4|YHAQ_BACSU Uncharacterized ABC transporter ATP-binding protein YhaQ OS=Bacillus subtilis (strain 168) GN=yhaQ PE=3 SV=1 1283 1505 2.0E-18
sp|Q8D653|CYSA_VIBVU Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio vulnificus (strain CMCP6) GN=cysA PE=3 SV=1 1283 1500 2.0E-18
sp|Q3KBH4|POTA_PSEPF Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf0-1) GN=potA PE=3 SV=1 1283 1506 2.0E-18
sp|Q9CK97|METN_PASMU Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1 520 718 2.0E-18
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 1283 1487 2.0E-18
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 1296 1473 2.0E-18
sp|P77509|YPHE_ECOLI Uncharacterized ABC transporter ATP-binding protein YphE OS=Escherichia coli (strain K12) GN=yphE PE=3 SV=1 1297 1485 2.0E-18
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 1285 1498 2.0E-18
sp|Q63TY1|CYSA_BURPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia pseudomallei (strain K96243) GN=cysA PE=3 SV=1 1282 1485 2.0E-18
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 1283 1498 2.0E-18
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 1283 1498 2.0E-18
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 1283 1498 2.0E-18
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 1283 1498 2.0E-18
sp|Q63S19|METN1_BURPS Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain K96243) GN=metN1 PE=3 SV=1 1283 1531 2.0E-18
sp|Q3JPZ4|METN1_BURP1 Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain 1710b) GN=metN1 PE=3 SV=1 1283 1531 2.0E-18
sp|Q62M41|METN1_BURMA Methionine import ATP-binding protein MetN 1 OS=Burkholderia mallei (strain ATCC 23344) GN=metN1 PE=3 SV=1 1283 1531 2.0E-18
sp|Q62K82|CYSA_BURMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia mallei (strain ATCC 23344) GN=cysA PE=3 SV=1 1282 1485 2.0E-18
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 525 725 3.0E-18
sp|Q8RGC8|FBPC_FUSNN Fe(3+) ions import ATP-binding protein FbpC OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fbpC PE=3 SV=1 1283 1485 3.0E-18
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 1283 1479 3.0E-18
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 1283 1479 3.0E-18
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 1283 1479 3.0E-18
sp|Q5WBL0|SSUB3_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Bacillus clausii (strain KSM-K16) GN=ssuB3 PE=3 SV=1 1283 1500 3.0E-18
sp|Q83MC5|METN_SHIFL Methionine import ATP-binding protein MetN OS=Shigella flexneri GN=metN PE=3 SV=1 490 709 3.0E-18
sp|Q0T810|METN_SHIF8 Methionine import ATP-binding protein MetN OS=Shigella flexneri serotype 5b (strain 8401) GN=metN PE=3 SV=1 490 709 3.0E-18
sp|Q04G50|POTA_OENOB Spermidine/putrescine import ATP-binding protein PotA OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=potA PE=3 SV=2 1287 1479 3.0E-18
sp|Q13LD8|METN2_BURXL Methionine import ATP-binding protein MetN 2 OS=Burkholderia xenovorans (strain LB400) GN=metN2 PE=3 SV=1 1297 1473 3.0E-18
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 526 718 3.0E-18
sp|Q3MAR5|POTA_ANAVT Spermidine/putrescine import ATP-binding protein PotA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=potA PE=3 SV=1 520 721 4.0E-18
sp|Q87PH3|POTA_VIBPA Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=potA PE=3 SV=1 1278 1481 4.0E-18
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 1283 1485 4.0E-18
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 1283 1486 4.0E-18
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 524 718 4.0E-18
sp|Q6NBT1|CYSA_RHOPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cysA PE=3 SV=1 1283 1494 4.0E-18
sp|Q6AM16|PSTB_DESPS Phosphate import ATP-binding protein PstB OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pstB PE=3 SV=1 1292 1506 4.0E-18
sp|Q8FVV5|FBPC_BRUSU Fe(3+) ions import ATP-binding protein FbpC OS=Brucella suis biovar 1 (strain 1330) GN=fbpC PE=3 SV=1 1287 1450 4.0E-18
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 526 713 5.0E-18
sp|Q146E7|TAUB1_BURXL Taurine import ATP-binding protein TauB 1 OS=Burkholderia xenovorans (strain LB400) GN=tauB1 PE=3 SV=1 517 722 5.0E-18
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 524 718 5.0E-18
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 1279 1485 5.0E-18
sp|Q578K3|FBPC_BRUAB Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus biovar 1 (strain 9-941) GN=fbpC PE=3 SV=1 1287 1479 5.0E-18
sp|Q2YKX3|FBPC_BRUA2 Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus (strain 2308) GN=fbpC PE=3 SV=1 1287 1479 5.0E-18
sp|Q9KS33|POTA_VIBCH Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=potA PE=3 SV=1 1279 1481 5.0E-18
sp|Q9Z3R9|AGLK_RHIME Alpha-glucoside transport ATP-binding protein AglK OS=Rhizobium meliloti (strain 1021) GN=aglK PE=3 SV=2 1282 1534 5.0E-18
sp|Q1DDP4|METN_MYXXD Methionine import ATP-binding protein MetN OS=Myxococcus xanthus (strain DK 1622) GN=metN PE=3 SV=1 524 718 5.0E-18
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 513 722 6.0E-18
sp|Q8FV85|METN_BRUSU Methionine import ATP-binding protein MetN OS=Brucella suis biovar 1 (strain 1330) GN=metN PE=3 SV=2 1283 1491 6.0E-18
sp|Q8YD40|METN_BRUME Methionine import ATP-binding protein MetN OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=metN PE=3 SV=1 1283 1491 6.0E-18
sp|Q579H8|METN_BRUAB Methionine import ATP-binding protein MetN OS=Brucella abortus biovar 1 (strain 9-941) GN=metN PE=3 SV=2 1283 1491 6.0E-18
sp|Q2YIV5|METN_BRUA2 Methionine import ATP-binding protein MetN OS=Brucella abortus (strain 2308) GN=metN PE=3 SV=2 1283 1491 6.0E-18
sp|Q2FRT7|ECFA2_METHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ecfA2 PE=3 SV=1 1297 1551 6.0E-18
sp|Q8ZRM9|METN1_SALTY Methionine import ATP-binding protein MetN 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN1 PE=3 SV=1 519 709 6.0E-18
sp|Q9KP42|THIQ_VIBCH Thiamine import ATP-binding protein ThiQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thiQ PE=3 SV=2 530 710 6.0E-18
sp|Q74L62|ECFA1_LACJO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=ecfA1 PE=3 SV=1 524 720 6.0E-18
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 1283 1486 7.0E-18
sp|Q890D1|Y100_LACPL Putative ABC transporter ATP-binding protein lp_0100 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_0100 PE=3 SV=2 1283 1481 7.0E-18
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 1279 1485 8.0E-18
sp|P55339|ECSA_BACSU ABC-type transporter ATP-binding protein EcsA OS=Bacillus subtilis (strain 168) GN=ecsA PE=1 SV=1 517 723 8.0E-18
sp|O32169|METN_BACSU Methionine import ATP-binding protein MetN OS=Bacillus subtilis (strain 168) GN=metN PE=1 SV=1 1285 1485 8.0E-18
sp|Q631Y4|METN3_BACCZ Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ZK / E33L) GN=metN3 PE=3 SV=1 1293 1487 8.0E-18
sp|Q81XL3|METN3_BACAN Methionine import ATP-binding protein MetN 3 OS=Bacillus anthracis GN=metN3 PE=3 SV=1 1293 1487 8.0E-18
sp|Q98HF7|POTA_RHILO Spermidine/putrescine import ATP-binding protein PotA OS=Rhizobium loti (strain MAFF303099) GN=potA PE=3 SV=1 1283 1494 9.0E-18
sp|Q6LX68|ECFA_METMP Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1 1283 1473 9.0E-18
sp|Q88UV2|METN2_LACPL Methionine import ATP-binding protein MetN 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN2 PE=3 SV=1 524 721 9.0E-18
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 1279 1485 9.0E-18
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 1283 1501 9.0E-18
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 526 719 1.0E-17
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 526 719 1.0E-17
sp|Q8YM92|POTA_NOSS1 Spermidine/putrescine import ATP-binding protein PotA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=potA PE=3 SV=1 520 721 1.0E-17
sp|O32169|METN_BACSU Methionine import ATP-binding protein MetN OS=Bacillus subtilis (strain 168) GN=metN PE=1 SV=1 524 718 1.0E-17
sp|Q1CFH7|METN2_YERPN Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metN2 PE=3 SV=1 519 718 1.0E-17
sp|Q8ZH38|METN1_YERPE Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis GN=metN1 PE=3 SV=1 519 718 1.0E-17
sp|Q1CAK4|METN1_YERPA Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metN1 PE=3 SV=1 519 718 1.0E-17
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 1283 1514 1.0E-17
sp|Q9KD30|MNTB_BACHD Manganese transport system ATP-binding protein MntB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mntB PE=3 SV=1 1283 1498 1.0E-17
sp|Q7VV72|METN_BORPE Methionine import ATP-binding protein MetN OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metN PE=3 SV=1 1283 1498 1.0E-17
sp|Q7W4E1|METN_BORPA Methionine import ATP-binding protein MetN OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metN PE=3 SV=1 1283 1498 1.0E-17
sp|Q7WFU9|METN_BORBR Methionine import ATP-binding protein MetN OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metN PE=3 SV=1 1283 1498 1.0E-17
sp|Q815Y7|METN3_BACCR Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN3 PE=3 SV=1 1293 1487 1.0E-17
sp|Q72Y96|METN3_BACC1 Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN3 PE=3 SV=1 1293 1487 1.0E-17
sp|Q1RGL1|ZNUC_RICBR Zinc import ATP-binding protein ZnuC OS=Rickettsia bellii (strain RML369-C) GN=znuC PE=3 SV=1 1287 1457 1.0E-17
sp|Q24XJ2|POTA_DESHY Spermidine/putrescine import ATP-binding protein PotA OS=Desulfitobacterium hafniense (strain Y51) GN=potA PE=3 SV=2 1280 1475 1.0E-17
sp|Q18AM3|POTA_PEPD6 Spermidine/putrescine import ATP-binding protein PotA OS=Peptoclostridium difficile (strain 630) GN=potA PE=3 SV=1 1283 1475 1.0E-17
sp|Q2K8C8|FBPC_RHIEC Fe(3+) ions import ATP-binding protein FbpC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fbpC PE=3 SV=1 1287 1481 1.0E-17
sp|P96063|PHNT_SALTY Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phnT PE=2 SV=1 1279 1485 1.0E-17
sp|Q1GIE5|POTA_RUEST Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria sp. (strain TM1040) GN=potA PE=3 SV=1 1283 1485 1.0E-17
sp|Q659V4|HMUV_PHODD Hemin import ATP-binding protein HmuV OS=Photobacterium damselae subsp. damselae GN=hmuV PE=3 SV=1 1282 1485 1.0E-17
sp|Q13KX9|TAUB2_BURXL Taurine import ATP-binding protein TauB 2 OS=Burkholderia xenovorans (strain LB400) GN=tauB2 PE=3 SV=1 1281 1488 1.0E-17
sp|Q5LVM5|TAUB_RUEPO Taurine import ATP-binding protein TauB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tauB PE=3 SV=1 1282 1488 1.0E-17
sp|Q6HBS0|METN2_BACHK Methionine import ATP-binding protein MetN 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metN2 PE=3 SV=1 1293 1487 1.0E-17
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 1283 1486 1.0E-17
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 1283 1486 1.0E-17
sp|Q5FKL2|METN_LACAC Methionine import ATP-binding protein MetN OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=metN PE=3 SV=1 524 725 1.0E-17
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 1283 1486 1.0E-17
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 1283 1486 1.0E-17
sp|Q67SV5|METN_SYMTH Methionine import ATP-binding protein MetN OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metN PE=3 SV=1 1283 1507 2.0E-17
sp|Q4FMG5|TAUB_PELUB Taurine import ATP-binding protein TauB OS=Pelagibacter ubique (strain HTCC1062) GN=tauB PE=3 SV=1 522 705 2.0E-17
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 1283 1498 2.0E-17
sp|Q8Z1U0|MALK_SALTI Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhi GN=malK PE=3 SV=1 1283 1535 2.0E-17
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 1283 1501 2.0E-17
sp|Q70GD4|HMUV_PHODP Hemin import ATP-binding protein HmuV OS=Photobacterium damsela subsp. piscicida GN=hmuV PE=3 SV=1 1282 1485 2.0E-17
sp|Q8Z990|METN1_SALTI Methionine import ATP-binding protein MetN 1 OS=Salmonella typhi GN=metN1 PE=3 SV=1 519 709 2.0E-17
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 1283 1487 2.0E-17
sp|Q9CP06|POTA_PASMU Spermidine/putrescine import ATP-binding protein PotA OS=Pasteurella multocida (strain Pm70) GN=potA PE=3 SV=2 1283 1487 2.0E-17
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 1283 1486 2.0E-17
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 1283 1486 2.0E-17
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 1283 1498 2.0E-17
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 1293 1473 2.0E-17
sp|Q576E0|Y3423_BRUAB Putative ATP-binding protein BruAb2_1123 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_1123 PE=3 SV=1 1287 1498 2.0E-17
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 526 714 2.0E-17
sp|P19566|MALK_SALTY Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=malK PE=1 SV=3 1283 1535 2.0E-17
sp|Q57GZ7|MALK_SALCH Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella choleraesuis (strain SC-B67) GN=malK PE=3 SV=1 1283 1535 2.0E-17
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 1283 1487 2.0E-17
sp|Q5WDP1|METN3_BACSK Methionine import ATP-binding protein MetN 3 OS=Bacillus clausii (strain KSM-K16) GN=metN3 PE=3 SV=1 524 767 2.0E-17
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 1300 1470 2.0E-17
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 1283 1486 2.0E-17
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 1283 1498 2.0E-17
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 1283 1545 2.0E-17
sp|Q5WDP1|METN3_BACSK Methionine import ATP-binding protein MetN 3 OS=Bacillus clausii (strain KSM-K16) GN=metN3 PE=3 SV=1 1283 1485 3.0E-17
sp|P22040|Y415_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0415 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0415 PE=3 SV=2 1292 1498 3.0E-17
sp|Q87RS1|METN_VIBPA Methionine import ATP-binding protein MetN OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metN PE=1 SV=1 519 714 3.0E-17
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 1253 1506 3.0E-17
sp|Q92WJ0|FBPC1_RHIME Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhizobium meliloti (strain 1021) GN=fbpC1 PE=3 SV=1 1287 1481 3.0E-17
sp|Q45460|OPUBA_BACSU Choline transport ATP-binding protein OpuBA OS=Bacillus subtilis (strain 168) GN=opuBA PE=2 SV=2 1283 1500 3.0E-17
sp|P26946|Y2279_BACPE Uncharacterized ABC transporter ATP-binding protein BpOF4_11395 OS=Bacillus pseudofirmus (strain OF4) GN=BpOF4_11395 PE=3 SV=2 542 790 3.0E-17
sp|Q8FUN3|Y4187_BRUSU Putative ATP-binding protein BRA1187/BS1330_II1178 OS=Brucella suis biovar 1 (strain 1330) GN=BRA1187 PE=3 SV=1 1287 1498 3.0E-17
sp|Q2YJB5|Y3647_BRUA2 Putative ATP-binding protein BAB2_1147 OS=Brucella abortus (strain 2308) GN=BAB2_1147 PE=3 SV=1 1287 1498 3.0E-17
sp|Q57T09|METN1_SALCH Methionine import ATP-binding protein MetN 1 OS=Salmonella choleraesuis (strain SC-B67) GN=metN1 PE=3 SV=2 519 709 3.0E-17
sp|Q9TKX3|CYSA_NEPOL Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1 1285 1498 3.0E-17
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 1283 1501 3.0E-17
sp|Q8U6M1|FBPC_AGRFC Fe(3+) ions import ATP-binding protein FbpC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fbpC PE=3 SV=1 1287 1481 3.0E-17
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 1297 1539 3.0E-17
sp|Q39AT4|METN2_BURL3 Methionine import ATP-binding protein MetN 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN2 PE=3 SV=1 1293 1473 3.0E-17
sp|Q4K681|POTA_PSEF5 Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=potA PE=3 SV=1 1297 1526 3.0E-17
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 1283 1485 3.0E-17
sp|Q6GIH9|METN2_STAAR Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MRSA252) GN=metN2 PE=3 SV=1 524 720 3.0E-17
sp|Q7N8M2|METN_PHOLL Methionine import ATP-binding protein MetN OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metN PE=3 SV=1 507 709 4.0E-17
sp|Q5PID0|METN1_SALPA Methionine import ATP-binding protein MetN 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN1 PE=3 SV=1 519 709 4.0E-17
sp|Q8YA75|METN1_LISMO Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN1 PE=3 SV=1 1283 1523 4.0E-17
sp|Q6D1C4|METN3_PECAS Methionine import ATP-binding protein MetN 3 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN3 PE=3 SV=1 519 709 4.0E-17
sp|Q724C0|METN1_LISMF Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metN1 PE=3 SV=1 1283 1523 4.0E-17
sp|Q2KVK2|METN_BORA1 Methionine import ATP-binding protein MetN OS=Bordetella avium (strain 197N) GN=metN PE=3 SV=1 1283 1486 4.0E-17
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 1283 1486 4.0E-17
sp|Q92EZ6|METN1_LISIN Methionine import ATP-binding protein MetN 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN1 PE=3 SV=1 1283 1523 4.0E-17
sp|Q8NXH5|METN2_STAAW Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MW2) GN=metN2 PE=3 SV=1 524 720 4.0E-17
sp|Q6GB18|METN2_STAAS Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MSSA476) GN=metN2 PE=3 SV=1 524 720 4.0E-17
sp|Q5HHK4|METN2_STAAC Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain COL) GN=metN2 PE=3 SV=1 524 720 4.0E-17
sp|Q2FZZ2|METN2_STAA8 Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN2 PE=3 SV=1 524 720 4.0E-17
sp|Q2FII2|METN2_STAA3 Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain USA300) GN=metN2 PE=3 SV=1 524 720 4.0E-17
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 1283 1485 4.0E-17
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 1283 1475 5.0E-17
sp|Q92G36|ZNUC_RICCN Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1 1287 1456 5.0E-17
sp|Q5PKZ8|MALK_SALPA Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=malK PE=3 SV=1 1283 1535 5.0E-17
sp|Q4L4R9|METN_STAHJ Methionine import ATP-binding protein MetN OS=Staphylococcus haemolyticus (strain JCSC1435) GN=metN PE=3 SV=1 524 720 5.0E-17
sp|Q7A6M2|METN2_STAAN Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain N315) GN=metN2 PE=1 SV=1 524 720 5.0E-17
sp|Q99VG8|METN2_STAAM Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metN2 PE=1 SV=1 524 720 5.0E-17
sp|Q2YWP2|METN2_STAAB Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metN2 PE=3 SV=1 524 720 5.0E-17
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 525 720 6.0E-17
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 525 720 6.0E-17
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 525 720 6.0E-17
sp|Q45460|OPUBA_BACSU Choline transport ATP-binding protein OpuBA OS=Bacillus subtilis (strain 168) GN=opuBA PE=2 SV=2 526 769 6.0E-17
sp|Q6D1C4|METN3_PECAS Methionine import ATP-binding protein MetN 3 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN3 PE=3 SV=1 1283 1486 6.0E-17
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 1283 1485 6.0E-17
sp|Q0AU85|METN_SYNWW Methionine import ATP-binding protein MetN OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=metN PE=3 SV=1 1283 1472 6.0E-17
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 1294 1479 6.0E-17
sp|Q21BU8|METN_RHOPB Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisB18) GN=metN PE=3 SV=1 524 715 6.0E-17
sp|O83658|POTA_TREPA Spermidine/putrescine import ATP-binding protein PotA OS=Treponema pallidum (strain Nichols) GN=potA PE=3 SV=1 1285 1501 6.0E-17
sp|Q7MN25|METN_VIBVY Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain YJ016) GN=metN PE=3 SV=1 519 718 6.0E-17
sp|Q160M2|POTA_ROSDO Spermidine/putrescine import ATP-binding protein PotA OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=potA PE=3 SV=1 1283 1514 6.0E-17
sp|Q8DFC3|METN_VIBVU Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain CMCP6) GN=metN PE=3 SV=1 519 718 6.0E-17
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 1283 1481 6.0E-17
sp|Q65F80|METN2_BACLD Methionine import ATP-binding protein MetN 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN2 PE=3 SV=1 1283 1485 7.0E-17
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 1296 1567 8.0E-17
sp|Q8YCG3|FBPC_BRUME Fe(3+) ions import ATP-binding protein FbpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fbpC PE=3 SV=1 1287 1479 8.0E-17
sp|Q9KUI0|CYSA_VIBCH Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysA PE=3 SV=1 1283 1486 8.0E-17
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 1283 1481 8.0E-17
sp|Q6AE21|METN_LEIXX Methionine import ATP-binding protein MetN OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=metN PE=3 SV=1 1287 1498 8.0E-17
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 1281 1523 8.0E-17
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 1283 1498 9.0E-17
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 518 713 9.0E-17
sp|Q0K2U3|TAUB_CUPNH Taurine import ATP-binding protein TauB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tauB PE=3 SV=1 1283 1481 9.0E-17
sp|Q2SY12|METN_BURTA Methionine import ATP-binding protein MetN OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=metN PE=3 SV=1 1283 1531 9.0E-17
sp|Q87SV4|THIQ_VIBPA Thiamine import ATP-binding protein ThiQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thiQ PE=3 SV=1 530 714 9.0E-17
sp|Q63H29|METN1_BACCZ Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ZK / E33L) GN=metN1 PE=3 SV=1 524 739 9.0E-17
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 1293 1473 9.0E-17
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 1293 1473 9.0E-17
sp|O34338|MNTB_BACSU Manganese transport system ATP-binding protein MntB OS=Bacillus subtilis (strain 168) GN=mntB PE=3 SV=1 1283 1506 9.0E-17
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 1287 1456 9.0E-17
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 526 718 1.0E-16
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 518 714 1.0E-16
sp|Q14Q07|POTA_SPICI Spermidine/putrescine import ATP-binding protein PotA OS=Spiroplasma citri GN=potA PE=3 SV=1 518 718 1.0E-16
sp|Q8P4S7|METN_XANCP Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=metN PE=3 SV=1 1283 1498 1.0E-16
sp|Q4UQD2|METN_XANC8 Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. campestris (strain 8004) GN=metN PE=3 SV=1 1283 1498 1.0E-16
sp|A5U7B7|FTSE_MYCTA Cell division ATP-binding protein FtsE OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ftsE PE=1 SV=1 1297 1482 1.0E-16
sp|Q9JZW0|CYSA_NEIMB Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysA PE=3 SV=1 1283 1475 1.0E-16
sp|Q5NN23|SSUB_ZYMMO Aliphatic sulfonates import ATP-binding protein SsuB OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ssuB PE=3 SV=1 524 709 1.0E-16
sp|O34992|OPUCA_BACSU Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA OS=Bacillus subtilis (strain 168) GN=opuCA PE=1 SV=1 526 774 1.0E-16
sp|O05779|FTSE_MYCTU Cell division ATP-binding protein FtsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsE PE=1 SV=2 1297 1482 1.0E-16
sp|Q18CI9|ECFA2_PEPD6 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Peptoclostridium difficile (strain 630) GN=ecfA2 PE=3 SV=1 1285 1479 1.0E-16
sp|Q5WJP0|METN2_BACSK Methionine import ATP-binding protein MetN 2 OS=Bacillus clausii (strain KSM-K16) GN=metN2 PE=3 SV=1 1283 1485 1.0E-16
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 1295 1485 1.0E-16
sp|Q81VM2|METN1_BACAN Methionine import ATP-binding protein MetN 1 OS=Bacillus anthracis GN=metN1 PE=3 SV=1 524 739 1.0E-16
sp|Q1WVG9|METN_LACS1 Methionine import ATP-binding protein MetN OS=Lactobacillus salivarius (strain UCC118) GN=metN PE=3 SV=1 519 725 1.0E-16
sp|Q83MA0|TAUB_SHIFL Taurine import ATP-binding protein TauB OS=Shigella flexneri GN=tauB PE=3 SV=1 1283 1486 1.0E-16
sp|Q7N986|MALK_PHOLL Maltose/maltodextrin import ATP-binding protein MalK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=malK PE=3 SV=1 1287 1538 1.0E-16
sp|Q5FA19|FBPC_NEIG1 Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbpC PE=1 SV=1 1283 1501 1.0E-16
sp|Q31DV4|PHNC_THICR Phosphonates import ATP-binding protein PhnC OS=Thiomicrospira crunogena (strain XCL-2) GN=phnC PE=3 SV=1 1297 1481 1.0E-16
sp|P54591|YHCG_BACSU Uncharacterized ABC transporter ATP-binding protein YhcG OS=Bacillus subtilis (strain 168) GN=yhcG PE=3 SV=1 526 723 2.0E-16
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 1283 1528 2.0E-16
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 526 720 2.0E-16
sp|O34992|OPUCA_BACSU Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA OS=Bacillus subtilis (strain 168) GN=opuCA PE=1 SV=1 1283 1500 2.0E-16
sp|Q73F11|METN1_BACC1 Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN1 PE=3 SV=1 524 739 2.0E-16
sp|A3DDF6|POTA_CLOTH Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=potA PE=3 SV=1 1283 1475 2.0E-16
sp|Q03ZL5|ECFA2_LEUMM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ecfA2 PE=1 SV=1 515 718 2.0E-16
sp|P77795|YDCT_ECOLI Uncharacterized ABC transporter ATP-binding protein YdcT OS=Escherichia coli (strain K12) GN=ydcT PE=3 SV=1 1287 1485 2.0E-16
sp|Q81IZ6|METN1_BACCR Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN1 PE=3 SV=1 524 739 2.0E-16
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 1294 1479 2.0E-16
sp|Q3JHC9|METN2_BURP1 Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain 1710b) GN=metN2 PE=3 SV=2 1293 1473 2.0E-16
sp|Q7MPC5|THIQ_VIBVY Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain YJ016) GN=thiQ PE=3 SV=1 529 721 2.0E-16
sp|Q8DE95|THIQ_VIBVU Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain CMCP6) GN=thiQ PE=3 SV=1 529 721 2.0E-16
sp|Q5E586|POTA_VIBF1 Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=potA PE=3 SV=1 1283 1481 2.0E-16
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 1283 1471 2.0E-16
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 1283 1471 2.0E-16
sp|Q4JTG9|METN_CORJK Methionine import ATP-binding protein MetN OS=Corynebacterium jeikeium (strain K411) GN=metN PE=3 SV=1 519 718 2.0E-16
sp|Q62B84|METN2_BURMA Methionine import ATP-binding protein MetN 2 OS=Burkholderia mallei (strain ATCC 23344) GN=metN2 PE=3 SV=2 1293 1473 2.0E-16
sp|O26236|Y133_METTH Putative ABC transporter ATP-binding protein MTH_133 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_133 PE=3 SV=1 526 718 2.0E-16
sp|Q63NI4|METN2_BURPS Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain K96243) GN=metN2 PE=3 SV=2 1293 1473 2.0E-16
sp|Q9KTJ5|METN_VIBCH Methionine import ATP-binding protein MetN OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=metN PE=3 SV=1 519 714 2.0E-16
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 1283 1498 2.0E-16
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 1297 1478 2.0E-16
sp|Q9JUX4|CYSA_NEIMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysA PE=3 SV=1 1283 1475 2.0E-16
sp|Q07LR5|METN_RHOP5 Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisA53) GN=metN PE=3 SV=1 483 718 2.0E-16
sp|Q8PGE8|METN_XANAC Methionine import ATP-binding protein MetN OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metN PE=3 SV=1 1283 1498 2.0E-16
sp|Q9RKC6|Y3161_STRCO Putative ABC transporter ATP-binding protein SCO3161 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3161 PE=3 SV=1 1295 1508 2.0E-16
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 1283 1486 2.0E-16
sp|Q2SJY7|POTA_HAHCH Spermidine/putrescine import ATP-binding protein PotA OS=Hahella chejuensis (strain KCTC 2396) GN=potA PE=3 SV=1 1283 1485 2.0E-16
sp|P9WQL6|FLQE1_MYCTO Fluoroquinolones export ATP-binding protein MT2762 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2762 PE=3 SV=1 519 719 3.0E-16
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 518 720 3.0E-16
sp|Q63H29|METN1_BACCZ Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ZK / E33L) GN=metN1 PE=3 SV=1 1283 1565 3.0E-16
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 1287 1481 3.0E-16
sp|P9WQL5|MKL_MYCTU Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mkl PE=1 SV=1 1283 1492 3.0E-16
sp|P9WQL4|MKL_MYCTO Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mkl PE=3 SV=1 1283 1492 3.0E-16
sp|P63358|MKL_MYCBO Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mkl PE=3 SV=1 1283 1492 3.0E-16
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 1300 1470 3.0E-16
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 1283 1485 3.0E-16
sp|Q87AL9|METN_XYLFT Methionine import ATP-binding protein MetN OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metN PE=3 SV=1 1290 1485 3.0E-16
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 1283 1521 3.0E-16
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 1283 1485 3.0E-16
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 1293 1486 3.0E-16
sp|P9WQL7|FLQE1_MYCTU Fluoroquinolones export ATP-binding protein Rv2688c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2688c PE=1 SV=1 519 719 4.0E-16
sp|P55339|ECSA_BACSU ABC-type transporter ATP-binding protein EcsA OS=Bacillus subtilis (strain 168) GN=ecsA PE=1 SV=1 1283 1505 4.0E-16
sp|Q87SV4|THIQ_VIBPA Thiamine import ATP-binding protein ThiQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thiQ PE=3 SV=1 1302 1498 4.0E-16
sp|Q5PJL1|UGPC_SALPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ugpC PE=3 SV=1 1282 1487 4.0E-16
sp|P15031|FECE_ECOLI Fe(3+) dicitrate transport ATP-binding protein FecE OS=Escherichia coli (strain K12) GN=fecE PE=2 SV=1 1283 1498 4.0E-16
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 1283 1494 4.0E-16
sp|Q0SFW6|METN2_RHOJR Methionine import ATP-binding protein MetN 2 OS=Rhodococcus jostii (strain RHA1) GN=metN2 PE=3 SV=1 1283 1495 4.0E-16
sp|P73265|NRTD_SYNY3 Putative nitrate transport ATP-binding protein NrtD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nrtD PE=3 SV=1 1283 1488 4.0E-16
sp|Q3Z300|LOLD_SHISS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella sonnei (strain Ss046) GN=lolD PE=3 SV=2 1283 1479 4.0E-16
sp|Q1RD37|LOLD_ECOUT Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli (strain UTI89 / UPEC) GN=lolD PE=3 SV=1 1283 1479 4.0E-16
sp|Q8FIM7|LOLD_ECOL6 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lolD PE=3 SV=1 1283 1479 4.0E-16
sp|Q0TIV6|LOLD_ECOL5 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lolD PE=3 SV=2 1283 1479 4.0E-16
sp|Q9HPH7|Y1631_HALSA Putative ABC transporter ATP-binding protein VNG_1631G OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1631G PE=3 SV=1 1283 1472 4.0E-16
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 527 718 5.0E-16
sp|Q32JQ8|METN_SHIDS Methionine import ATP-binding protein MetN OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metN PE=3 SV=1 1283 1473 5.0E-16
sp|P30750|METN_ECOLI Methionine import ATP-binding protein MetN OS=Escherichia coli (strain K12) GN=metN PE=1 SV=4 1283 1473 5.0E-16
sp|P19844|NOSF_PSEST Copper transport ATP-binding protein NosF OS=Pseudomonas stutzeri GN=nosF PE=3 SV=1 518 729 5.0E-16
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 526 721 5.0E-16
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 525 718 5.0E-16
sp|Q65F80|METN2_BACLD Methionine import ATP-binding protein MetN 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN2 PE=3 SV=1 524 722 5.0E-16
sp|Q8Z245|UGPC_SALTI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhi GN=ugpC PE=3 SV=1 1282 1487 5.0E-16
sp|Q87J32|HMUV_VIBPA Hemin import ATP-binding protein HmuV OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hmuV PE=3 SV=2 1287 1485 5.0E-16
sp|Q9AT00|TGD3_ARATH Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic OS=Arabidopsis thaliana GN=TGD3 PE=1 SV=1 1283 1458 5.0E-16
sp|Q8ZLF4|UGPC_SALTY sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ugpC PE=1 SV=1 1282 1487 5.0E-16
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 1290 1488 5.0E-16
sp|O34641|YTRB_BACSU ABC transporter ATP-binding protein YtrB OS=Bacillus subtilis (strain 168) GN=ytrB PE=2 SV=1 1283 1499 5.0E-16
sp|P33982|Y3926_AZOC5 Probable ABC transporter ATP-binding protein AZC_3926 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=AZC_3926 PE=3 SV=1 507 714 5.0E-16
sp|Q4W575|FBPC_NEIMB Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbpC PE=3 SV=1 1283 1501 5.0E-16
sp|Q9JVH1|FBPC_NEIMA Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbpC PE=3 SV=1 1283 1501 5.0E-16
sp|Q65QT6|MALK_MANSM Maltose/maltodextrin import ATP-binding protein MalK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=malK PE=3 SV=1 1287 1537 5.0E-16
sp|Q5NFU5|METN_FRATT Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=metN PE=3 SV=2 1283 1491 5.0E-16
sp|Q0BMC9|METN_FRATO Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=metN PE=3 SV=1 1283 1491 5.0E-16
sp|Q2A3Z2|METN_FRATH Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain LVS) GN=metN PE=3 SV=1 1283 1491 5.0E-16
sp|P25885|Y382_RHIME Uncharacterized ABC transporter ATP-binding protein R00382 OS=Rhizobium meliloti (strain 1021) GN=R00382 PE=3 SV=1 1288 1485 5.0E-16
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 1282 1482 5.0E-16
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 526 715 6.0E-16
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 526 718 6.0E-16
sp|Q0TLD2|METN_ECOL5 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metN PE=3 SV=1 1283 1473 6.0E-16
sp|Q3Z5F8|METN_SHISS Methionine import ATP-binding protein MetN OS=Shigella sonnei (strain Ss046) GN=metN PE=3 SV=1 1283 1473 6.0E-16
sp|Q1RFY9|METN_ECOUT Methionine import ATP-binding protein MetN OS=Escherichia coli (strain UTI89 / UPEC) GN=metN PE=3 SV=1 1283 1473 6.0E-16
sp|P63355|METN_ECOL6 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metN PE=3 SV=1 1283 1473 6.0E-16
sp|P63356|METN_ECO57 Methionine import ATP-binding protein MetN OS=Escherichia coli O157:H7 GN=metN PE=3 SV=1 1283 1473 6.0E-16
sp|Q325U1|METN_SHIBS Methionine import ATP-binding protein MetN OS=Shigella boydii serotype 4 (strain Sb227) GN=metN PE=3 SV=1 1283 1473 6.0E-16
sp|Q8X8E3|LOLD_ECO57 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O157:H7 GN=lolD PE=3 SV=2 1283 1479 6.0E-16
sp|Q68Y13|ZNUC_RICTY Zinc import ATP-binding protein ZnuC OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=znuC PE=3 SV=1 1287 1456 6.0E-16
sp|Q57IS3|UGPC_SALCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella choleraesuis (strain SC-B67) GN=ugpC PE=3 SV=1 1282 1487 6.0E-16
sp|Q65M34|METN1_BACLD Methionine import ATP-binding protein MetN 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN1 PE=3 SV=1 522 714 6.0E-16
sp|Q9ZCC4|ZNUC_RICPR Zinc import ATP-binding protein ZnuC OS=Rickettsia prowazekii (strain Madrid E) GN=znuC PE=3 SV=1 1287 1456 6.0E-16
sp|Q4KK16|TAUB_PSEF5 Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tauB PE=3 SV=1 520 705 6.0E-16
sp|Q6LR20|POTA_PHOPR Spermidine/putrescine import ATP-binding protein PotA OS=Photobacterium profundum GN=potA PE=3 SV=1 1283 1481 6.0E-16
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 1293 1470 6.0E-16
sp|Q6F9P2|METN2_ACIAD Methionine import ATP-binding protein MetN 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN2 PE=3 SV=1 522 718 6.0E-16
sp|P24693|LPTB_ACIFR Lipopolysaccharide export system ATP-binding protein LptB OS=Acidithiobacillus ferrooxidans GN=lptB PE=3 SV=1 1281 1498 6.0E-16
sp|Q8DU24|PSTB1_STRMU Phosphate import ATP-binding protein PstB 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pstB1 PE=3 SV=1 1283 1498 6.0E-16
sp|Q5X484|METN_LEGPA Methionine import ATP-binding protein MetN OS=Legionella pneumophila (strain Paris) GN=metN PE=3 SV=1 1283 1529 6.0E-16
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 527 718 7.0E-16
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 527 712 7.0E-16
sp|Q8ZRM9|METN1_SALTY Methionine import ATP-binding protein MetN 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN1 PE=3 SV=1 1283 1473 7.0E-16
sp|Q0T7M2|TAUB_SHIF8 Taurine import ATP-binding protein TauB OS=Shigella flexneri serotype 5b (strain 8401) GN=tauB PE=3 SV=1 1283 1486 7.0E-16
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 530 704 7.0E-16
sp|P30769|MKL_MYCLE Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium leprae (strain TN) GN=mkl PE=3 SV=2 1283 1492 7.0E-16
sp|Q830W6|POTA_ENTFA Spermidine/putrescine import ATP-binding protein PotA OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=potA PE=3 SV=1 1287 1479 7.0E-16
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 527 712 8.0E-16
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 527 712 8.0E-16
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 527 712 8.0E-16
sp|Q5YZY9|CYSA_NOCFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1 526 721 9.0E-16
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 527 712 9.0E-16
sp|Q8ZPK4|OSMV_SALTY Osmoprotectant import ATP-binding protein OsmV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=osmV PE=1 SV=1 1283 1498 9.0E-16
sp|Q81VM2|METN1_BACAN Methionine import ATP-binding protein MetN 1 OS=Bacillus anthracis GN=metN1 PE=3 SV=1 1283 1565 9.0E-16
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 527 712 1.0E-15
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 527 720 1.0E-15
sp|Q576E0|Y3423_BRUAB Putative ATP-binding protein BruAb2_1123 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_1123 PE=3 SV=1 525 705 1.0E-15
sp|Q5PID0|METN1_SALPA Methionine import ATP-binding protein MetN 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN1 PE=3 SV=1 1283 1473 1.0E-15
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 526 720 1.0E-15
sp|P33982|Y3926_AZOC5 Probable ABC transporter ATP-binding protein AZC_3926 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=AZC_3926 PE=3 SV=1 1261 1485 1.0E-15
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 1283 1498 2.0E-15
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 1283 1498 2.0E-15
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 518 720 2.0E-15
sp|Q9CK97|METN_PASMU Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1 1296 1498 2.0E-15
sp|Q83MC5|METN_SHIFL Methionine import ATP-binding protein MetN OS=Shigella flexneri GN=metN PE=3 SV=1 1283 1473 2.0E-15
sp|Q0T810|METN_SHIF8 Methionine import ATP-binding protein MetN OS=Shigella flexneri serotype 5b (strain 8401) GN=metN PE=3 SV=1 1283 1473 2.0E-15
sp|Q9Z3R9|AGLK_RHIME Alpha-glucoside transport ATP-binding protein AglK OS=Rhizobium meliloti (strain 1021) GN=aglK PE=3 SV=2 519 721 2.0E-15
sp|Q6LX68|ECFA_METMP Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1 525 718 2.0E-15
sp|Q8Z990|METN1_SALTI Methionine import ATP-binding protein MetN 1 OS=Salmonella typhi GN=metN1 PE=3 SV=1 1283 1473 2.0E-15
sp|Q8FUN3|Y4187_BRUSU Putative ATP-binding protein BRA1187/BS1330_II1178 OS=Brucella suis biovar 1 (strain 1330) GN=BRA1187 PE=3 SV=1 525 705 2.0E-15
sp|Q2YJB5|Y3647_BRUA2 Putative ATP-binding protein BAB2_1147 OS=Brucella abortus (strain 2308) GN=BAB2_1147 PE=3 SV=1 525 705 2.0E-15
sp|Q81IZ6|METN1_BACCR Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN1 PE=3 SV=1 1283 1565 2.0E-15
sp|P31134|POTG_ECOLI Putrescine transport ATP-binding protein PotG OS=Escherichia coli (strain K12) GN=potG PE=3 SV=2 526 755 3.0E-15
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 525 720 3.0E-15
sp|Q2T751|TAUB_BURTA Taurine import ATP-binding protein TauB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tauB PE=3 SV=1 524 729 3.0E-15
sp|Q8D653|CYSA_VIBVU Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio vulnificus (strain CMCP6) GN=cysA PE=3 SV=1 526 718 3.0E-15
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 527 714 3.0E-15
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 518 721 4.0E-15
sp|Q63JZ3|TAUB_BURPS Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain K96243) GN=tauB PE=3 SV=1 524 729 4.0E-15
sp|Q57T09|METN1_SALCH Methionine import ATP-binding protein MetN 1 OS=Salmonella choleraesuis (strain SC-B67) GN=metN1 PE=3 SV=2 1283 1473 4.0E-15
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 525 718 4.0E-15
sp|Q3JKX3|TAUB_BURP1 Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain 1710b) GN=tauB PE=3 SV=1 524 729 5.0E-15
sp|Q62AW4|TAUB_BURMA Taurine import ATP-binding protein TauB OS=Burkholderia mallei (strain ATCC 23344) GN=tauB PE=3 SV=1 524 729 5.0E-15
sp|Q97KS6|POTA_CLOAB Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=potA PE=3 SV=1 527 714 5.0E-15
sp|Q28K97|TAUB_JANSC Taurine import ATP-binding protein TauB OS=Jannaschia sp. (strain CCS1) GN=tauB PE=3 SV=1 524 705 6.0E-15
sp|P73265|NRTD_SYNY3 Putative nitrate transport ATP-binding protein NrtD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nrtD PE=3 SV=1 524 705 6.0E-15
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 527 718 7.0E-15
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 525 718 7.0E-15
sp|P44531|FBPC1_HAEIN Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1 525 760 9.0E-15
sp|Q6AE21|METN_LEIXX Methionine import ATP-binding protein MetN OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=metN PE=3 SV=1 511 718 9.0E-15
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 527 718 1.0E-14
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 525 721 1.0E-14
sp|Q9K789|METN_BACHD Methionine import ATP-binding protein MetN OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metN PE=3 SV=1 524 718 1.0E-14
sp|Q9MUN1|CYSA_MESVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Mesostigma viride GN=cysA PE=3 SV=1 526 721 1.0E-14
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 526 707 1.0E-14
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 524 713 1.0E-14
sp|Q5WJP0|METN2_BACSK Methionine import ATP-binding protein MetN 2 OS=Bacillus clausii (strain KSM-K16) GN=metN2 PE=3 SV=1 524 713 1.0E-14
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 514 721 1.0E-14
sp|Q5X484|METN_LEGPA Methionine import ATP-binding protein MetN OS=Legionella pneumophila (strain Paris) GN=metN PE=3 SV=1 525 709 1.0E-14
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 525 721 2.0E-14
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 526 718 2.0E-14
sp|Q07756|NODI_AZOC5 Nod factor export ATP-binding protein I OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodI PE=3 SV=1 527 711 2.0E-14
sp|Q631Y4|METN3_BACCZ Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ZK / E33L) GN=metN3 PE=3 SV=1 524 718 2.0E-14
sp|Q81XL3|METN3_BACAN Methionine import ATP-binding protein MetN 3 OS=Bacillus anthracis GN=metN3 PE=3 SV=1 524 718 2.0E-14
sp|Q815Y7|METN3_BACCR Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN3 PE=3 SV=1 524 718 2.0E-14
sp|Q72Y96|METN3_BACC1 Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN3 PE=3 SV=1 524 718 2.0E-14
sp|Q6HBS0|METN2_BACHK Methionine import ATP-binding protein MetN 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metN2 PE=3 SV=1 524 718 2.0E-14
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 526 718 2.0E-14
sp|Q9JZW0|CYSA_NEIMB Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysA PE=3 SV=1 526 715 2.0E-14
sp|Q7N986|MALK_PHOLL Maltose/maltodextrin import ATP-binding protein MalK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=malK PE=3 SV=1 522 718 2.0E-14
sp|Q0SFW6|METN2_RHOJR Methionine import ATP-binding protein MetN 2 OS=Rhodococcus jostii (strain RHA1) GN=metN2 PE=3 SV=1 518 714 2.0E-14
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 518 718 3.0E-14
sp|Q2YAD6|POTA_NITMU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=potA PE=3 SV=1 526 710 3.0E-14
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 526 721 3.0E-14
sp|Q9JUX4|CYSA_NEIMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysA PE=3 SV=1 526 715 3.0E-14
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 526 721 4.0E-14
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 524 721 4.0E-14
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 526 714 4.0E-14
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 526 707 4.0E-14
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 526 707 4.0E-14
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 526 795 5.0E-14
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 518 709 5.0E-14
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 524 714 5.0E-14
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 525 720 5.0E-14
sp|O34977|YTHP_BACSU Uncharacterized ABC transporter ATP-binding protein YthP OS=Bacillus subtilis (strain 168) GN=ythP PE=3 SV=1 1294 1503 5.0E-14
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 526 720 5.0E-14
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 527 720 6.0E-14
sp|Q73F11|METN1_BACC1 Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN1 PE=3 SV=1 1283 1485 6.0E-14
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 527 718 7.0E-14
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 527 720 7.0E-14
sp|Q8FV85|METN_BRUSU Methionine import ATP-binding protein MetN OS=Brucella suis biovar 1 (strain 1330) GN=metN PE=3 SV=2 526 713 7.0E-14
sp|Q8YD40|METN_BRUME Methionine import ATP-binding protein MetN OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=metN PE=3 SV=1 526 713 7.0E-14
sp|Q579H8|METN_BRUAB Methionine import ATP-binding protein MetN OS=Brucella abortus biovar 1 (strain 9-941) GN=metN PE=3 SV=2 526 713 7.0E-14
sp|Q2YIV5|METN_BRUA2 Methionine import ATP-binding protein MetN OS=Brucella abortus (strain 2308) GN=metN PE=3 SV=2 526 713 7.0E-14
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 525 714 7.0E-14
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 526 718 8.0E-14
sp|O31427|SKFE_BACSU SkfA peptide export ATP-binding protein SkfE OS=Bacillus subtilis (strain 168) GN=skfE PE=1 SV=1 526 709 8.0E-14
sp|Q1GIE5|POTA_RUEST Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria sp. (strain TM1040) GN=potA PE=3 SV=1 490 722 8.0E-14
sp|Q21BU8|METN_RHOPB Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisB18) GN=metN PE=3 SV=1 1282 1487 8.0E-14
sp|O83658|POTA_TREPA Spermidine/putrescine import ATP-binding protein PotA OS=Treponema pallidum (strain Nichols) GN=potA PE=3 SV=1 525 721 8.0E-14
sp|P25885|Y382_RHIME Uncharacterized ABC transporter ATP-binding protein R00382 OS=Rhizobium meliloti (strain 1021) GN=R00382 PE=3 SV=1 527 718 8.0E-14
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 518 721 9.0E-14
sp|P63354|CYSA_BRUSU Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella suis biovar 1 (strain 1330) GN=cysA PE=3 SV=1 526 721 9.0E-14
sp|P63353|CYSA_BRUME Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=cysA PE=3 SV=1 526 721 9.0E-14
sp|Q0TA26|MALK_ECOL5 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=malK PE=3 SV=1 524 726 9.0E-14
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 526 718 9.0E-14
sp|Q7VV72|METN_BORPE Methionine import ATP-binding protein MetN OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metN PE=3 SV=1 526 718 9.0E-14
sp|Q7W4E1|METN_BORPA Methionine import ATP-binding protein MetN OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metN PE=3 SV=1 526 718 9.0E-14
sp|Q7WFU9|METN_BORBR Methionine import ATP-binding protein MetN OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metN PE=3 SV=1 526 718 9.0E-14
sp|Q92XW1|CYSA1_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Rhizobium meliloti (strain 1021) GN=cysA1 PE=3 SV=1 526 718 1.0E-13
sp|P54592|YHCH_BACSU Uncharacterized ABC transporter ATP-binding protein YhcH OS=Bacillus subtilis (strain 168) GN=yhcH PE=3 SV=1 527 709 1.0E-13
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 518 714 1.0E-13
sp|P42332|BCRA_BACLI Bacitracin transport ATP-binding protein BcrA OS=Bacillus licheniformis GN=bcrA PE=3 SV=1 517 721 1.0E-13
sp|Q57855|Y412_METJA Uncharacterized ABC transporter ATP-binding protein MJ0412 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0412 PE=3 SV=1 524 705 1.0E-13
sp|Q13LD8|METN2_BURXL Methionine import ATP-binding protein MetN 2 OS=Burkholderia xenovorans (strain LB400) GN=metN2 PE=3 SV=1 526 713 1.0E-13
sp|Q8Z1U0|MALK_SALTI Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhi GN=malK PE=3 SV=1 524 726 1.0E-13
sp|P22040|Y415_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0415 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0415 PE=3 SV=2 521 792 1.0E-13
sp|Q7N8M2|METN_PHOLL Methionine import ATP-binding protein MetN OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metN PE=3 SV=1 1296 1486 1.0E-13
sp|Q5PKZ8|MALK_SALPA Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=malK PE=3 SV=1 524 726 1.0E-13
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 526 720 1.0E-13
sp|Q5NN23|SSUB_ZYMMO Aliphatic sulfonates import ATP-binding protein SsuB OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ssuB PE=3 SV=1 1283 1492 1.0E-13
sp|Q4JTG9|METN_CORJK Methionine import ATP-binding protein MetN OS=Corynebacterium jeikeium (strain K411) GN=metN PE=3 SV=1 1287 1520 1.0E-13
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 518 714 1.0E-13
sp|Q65M34|METN1_BACLD Methionine import ATP-binding protein MetN 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN1 PE=3 SV=1 1297 1495 1.0E-13
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 527 718 2.0E-13
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 526 718 2.0E-13
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 524 726 2.0E-13
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 524 726 2.0E-13
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 524 726 2.0E-13
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 524 726 2.0E-13
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 524 726 2.0E-13
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 524 726 2.0E-13
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 524 726 2.0E-13
sp|Q6ME20|METN_PARUW Methionine import ATP-binding protein MetN OS=Protochlamydia amoebophila (strain UWE25) GN=metN PE=3 SV=1 518 705 2.0E-13
sp|Q1DDP4|METN_MYXXD Methionine import ATP-binding protein MetN OS=Myxococcus xanthus (strain DK 1622) GN=metN PE=3 SV=1 1285 1521 2.0E-13
sp|Q88UV2|METN2_LACPL Methionine import ATP-binding protein MetN 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN2 PE=3 SV=1 1287 1546 2.0E-13
sp|Q1CFH7|METN2_YERPN Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metN2 PE=3 SV=1 1283 1498 2.0E-13
sp|Q8ZH38|METN1_YERPE Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis GN=metN1 PE=3 SV=1 1283 1498 2.0E-13
sp|Q1CAK4|METN1_YERPA Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metN1 PE=3 SV=1 1283 1498 2.0E-13
sp|Q5LVM5|TAUB_RUEPO Taurine import ATP-binding protein TauB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tauB PE=3 SV=1 524 705 2.0E-13
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 526 713 2.0E-13
sp|P19566|MALK_SALTY Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=malK PE=1 SV=3 524 726 2.0E-13
sp|Q57GZ7|MALK_SALCH Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella choleraesuis (strain SC-B67) GN=malK PE=3 SV=1 524 726 2.0E-13
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 530 720 2.0E-13
sp|Q0K2U3|TAUB_CUPNH Taurine import ATP-binding protein TauB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tauB PE=3 SV=1 525 705 2.0E-13
sp|Q1WVG9|METN_LACS1 Methionine import ATP-binding protein MetN OS=Lactobacillus salivarius (strain UCC118) GN=metN PE=3 SV=1 1297 1514 2.0E-13
sp|O26236|Y133_METTH Putative ABC transporter ATP-binding protein MTH_133 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_133 PE=3 SV=1 1297 1486 2.0E-13
sp|Q07LR5|METN_RHOP5 Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisA53) GN=metN PE=3 SV=1 1276 1556 2.0E-13
sp|Q5NFU5|METN_FRATT Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=metN PE=3 SV=2 525 718 2.0E-13
sp|Q0BMC9|METN_FRATO Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=metN PE=3 SV=1 525 718 2.0E-13
sp|Q2A3Z2|METN_FRATH Methionine import ATP-binding protein MetN OS=Francisella tularensis subsp. holarctica (strain LVS) GN=metN PE=3 SV=1 525 718 2.0E-13
sp|Q110U3|POTA_TRIEI Spermidine/putrescine import ATP-binding protein PotA OS=Trichodesmium erythraeum (strain IMS101) GN=potA PE=3 SV=1 526 720 3.0E-13
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 526 718 3.0E-13
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 1282 1485 3.0E-13
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 518 720 4.0E-13
sp|Q667L9|METN2_YERPS Methionine import ATP-binding protein MetN 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN2 PE=3 SV=1 1283 1498 4.0E-13
sp|Q8YA75|METN1_LISMO Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN1 PE=3 SV=1 524 718 4.0E-13
sp|Q724C0|METN1_LISMF Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metN1 PE=3 SV=1 524 718 4.0E-13
sp|Q0AU85|METN_SYNWW Methionine import ATP-binding protein MetN OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=metN PE=3 SV=1 490 713 4.0E-13
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 482 718 4.0E-13
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 527 704 4.0E-13
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 524 705 5.0E-13
sp|O85818|POTA_AGGAC Spermidine/putrescine import ATP-binding protein PotA OS=Aggregatibacter actinomycetemcomitans GN=potA PE=3 SV=1 527 720 5.0E-13
sp|Q89UD2|CYSA_BRADU Sulfate/thiosulfate import ATP-binding protein CysA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cysA PE=3 SV=1 526 720 5.0E-13
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 530 729 5.0E-13
sp|Q9KUI0|CYSA_VIBCH Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysA PE=3 SV=1 526 762 5.0E-13
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 526 718 6.0E-13
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 526 718 6.0E-13
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 518 720 6.0E-13
sp|P42246|YCBN_BACSU Uncharacterized ABC transporter ATP-binding protein YcbN OS=Bacillus subtilis (strain 168) GN=ycbN PE=3 SV=4 527 709 6.0E-13
sp|Q6NBT1|CYSA_RHOPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cysA PE=3 SV=1 526 721 6.0E-13
sp|Q3JHC9|METN2_BURP1 Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain 1710b) GN=metN2 PE=3 SV=2 523 713 6.0E-13
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 527 709 7.0E-13
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 527 709 7.0E-13
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 527 718 7.0E-13
sp|Q2K8C8|FBPC_RHIEC Fe(3+) ions import ATP-binding protein FbpC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fbpC PE=3 SV=1 526 720 7.0E-13
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 522 714 7.0E-13
sp|Q62B84|METN2_BURMA Methionine import ATP-binding protein MetN 2 OS=Burkholderia mallei (strain ATCC 23344) GN=metN2 PE=3 SV=2 523 713 7.0E-13
sp|Q63NI4|METN2_BURPS Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain K96243) GN=metN2 PE=3 SV=2 523 713 7.0E-13
sp|Q39AT4|METN2_BURL3 Methionine import ATP-binding protein MetN 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN2 PE=3 SV=1 526 713 8.0E-13
sp|Q8Z245|UGPC_SALTI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhi GN=ugpC PE=3 SV=1 506 721 8.0E-13
sp|Q5WBL0|SSUB3_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Bacillus clausii (strain KSM-K16) GN=ssuB3 PE=3 SV=1 527 709 9.0E-13
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 526 707 9.0E-13
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 526 707 9.0E-13
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 526 714 1.0E-12
sp|Q1AS06|POTA_RUBXD Spermidine/putrescine import ATP-binding protein PotA OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=potA PE=3 SV=1 526 720 1.0E-12
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 527 714 1.0E-12
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 527 707 1.0E-12
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 526 707 1.0E-12
sp|Q9CP06|POTA_PASMU Spermidine/putrescine import ATP-binding protein PotA OS=Pasteurella multocida (strain Pm70) GN=potA PE=3 SV=2 527 720 1.0E-12
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 526 710 1.0E-12
sp|Q92EZ6|METN1_LISIN Methionine import ATP-binding protein MetN 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN1 PE=3 SV=1 524 718 1.0E-12
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 525 718 1.0E-12
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 525 718 1.0E-12
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 526 713 1.0E-12
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 526 713 1.0E-12
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 530 729 1.0E-12
sp|P24693|LPTB_ACIFR Lipopolysaccharide export system ATP-binding protein LptB OS=Acidithiobacillus ferrooxidans GN=lptB PE=3 SV=1 537 718 1.0E-12
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 527 714 2.0E-12
sp|Q72FW5|POTA_DESVH Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=potA PE=3 SV=1 518 729 2.0E-12
sp|A1TAI4|POTA_MYCVP Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=potA PE=3 SV=1 525 721 2.0E-12
sp|Q63TY1|CYSA_BURPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia pseudomallei (strain K96243) GN=cysA PE=3 SV=1 526 714 2.0E-12
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 527 718 2.0E-12
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 527 718 2.0E-12
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 527 718 2.0E-12
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 527 718 2.0E-12
sp|Q146E7|TAUB1_BURXL Taurine import ATP-binding protein TauB 1 OS=Burkholderia xenovorans (strain LB400) GN=tauB1 PE=3 SV=1 1295 1481 2.0E-12
sp|Q1RGL1|ZNUC_RICBR Zinc import ATP-binding protein ZnuC OS=Rickettsia bellii (strain RML369-C) GN=znuC PE=3 SV=1 527 691 2.0E-12
sp|Q5PJL1|UGPC_SALPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ugpC PE=3 SV=1 506 721 2.0E-12
sp|Q65QT6|MALK_MANSM Maltose/maltodextrin import ATP-binding protein MalK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=malK PE=3 SV=1 530 726 2.0E-12
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 522 709 3.0E-12
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 527 714 3.0E-12
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 526 720 3.0E-12
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 518 718 3.0E-12
sp|Q62K82|CYSA_BURMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia mallei (strain ATCC 23344) GN=cysA PE=3 SV=1 526 714 3.0E-12
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 525 721 3.0E-12
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 1295 1494 3.0E-12
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 530 707 3.0E-12
sp|Q160M2|POTA_ROSDO Spermidine/putrescine import ATP-binding protein PotA OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=potA PE=3 SV=1 526 721 3.0E-12
sp|Q5FA19|FBPC_NEIG1 Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbpC PE=1 SV=1 518 718 3.0E-12
sp|Q8EPK1|METN1_OCEIH Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2 524 718 4.0E-12
sp|Q7NWX3|CYSA2_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA2 PE=3 SV=1 526 718 4.0E-12
sp|Q82TL6|POTA_NITEU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=potA PE=3 SV=1 526 714 4.0E-12
sp|Q4KK16|TAUB_PSEF5 Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tauB PE=3 SV=1 1300 1486 4.0E-12
sp|Q65UE1|POTA_MANSM Spermidine/putrescine import ATP-binding protein PotA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=potA PE=3 SV=1 527 720 5.0E-12
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 525 715 5.0E-12
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 525 715 5.0E-12
sp|P96063|PHNT_SALTY Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phnT PE=2 SV=1 525 721 5.0E-12
sp|Q8U6M1|FBPC_AGRFC Fe(3+) ions import ATP-binding protein FbpC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fbpC PE=3 SV=1 526 720 5.0E-12
sp|Q8ZLF4|UGPC_SALTY sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ugpC PE=1 SV=1 506 721 5.0E-12
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 519 721 6.0E-12
sp|Q18AM3|POTA_PEPD6 Spermidine/putrescine import ATP-binding protein PotA OS=Peptoclostridium difficile (strain 630) GN=potA PE=3 SV=1 518 718 6.0E-12
sp|Q2SY12|METN_BURTA Methionine import ATP-binding protein MetN OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=metN PE=3 SV=1 524 718 6.0E-12
sp|Q2SJY7|POTA_HAHCH Spermidine/putrescine import ATP-binding protein PotA OS=Hahella chejuensis (strain KCTC 2396) GN=potA PE=3 SV=1 527 720 6.0E-12
sp|Q57IS3|UGPC_SALCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella choleraesuis (strain SC-B67) GN=ugpC PE=3 SV=1 506 721 6.0E-12
sp|Q0AGF4|POTA_NITEC Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas eutropha (strain C91) GN=potA PE=3 SV=1 526 714 7.0E-12
sp|A1TXH7|POTA_MARHV Spermidine/putrescine import ATP-binding protein PotA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=potA PE=3 SV=1 526 721 7.0E-12
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 527 709 7.0E-12
sp|Q8YCG3|FBPC_BRUME Fe(3+) ions import ATP-binding protein FbpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fbpC PE=3 SV=1 526 720 7.0E-12
sp|Q83MA0|TAUB_SHIFL Taurine import ATP-binding protein TauB OS=Shigella flexneri GN=tauB PE=3 SV=1 526 707 7.0E-12
sp|Q830W6|POTA_ENTFA Spermidine/putrescine import ATP-binding protein PotA OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=potA PE=3 SV=1 522 718 7.0E-12
sp|Q98K23|CYSA_RHILO Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhizobium loti (strain MAFF303099) GN=cysA PE=3 SV=1 526 718 8.0E-12
sp|Q04G50|POTA_OENOB Spermidine/putrescine import ATP-binding protein PotA OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=potA PE=3 SV=2 530 718 8.0E-12
sp|Q9KP42|THIQ_VIBCH Thiamine import ATP-binding protein ThiQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thiQ PE=3 SV=2 1303 1487 8.0E-12
sp|Q87RS1|METN_VIBPA Methionine import ATP-binding protein MetN OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=metN PE=1 SV=1 1283 1486 8.0E-12
sp|Q4K681|POTA_PSEF5 Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=potA PE=3 SV=1 525 721 8.0E-12
sp|P38046|NRTD_SYNE7 Nitrate transport ATP-binding protein NrtD OS=Synechococcus elongatus (strain PCC 7942) GN=nrtD PE=3 SV=1 1293 1485 9.0E-12
sp|O34641|YTRB_BACSU ABC transporter ATP-binding protein YtrB OS=Bacillus subtilis (strain 168) GN=ytrB PE=2 SV=1 530 722 9.0E-12
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 526 709 1.0E-11
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 522 721 1.0E-11
sp|Q02R79|POTA_PSEAB Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=potA PE=3 SV=1 526 707 1.0E-11
sp|Q9HY19|POTA2_PSEAE Spermidine/putrescine import ATP-binding protein PotA 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA2 PE=3 SV=1 526 707 1.0E-11
sp|A1B9H9|SSUB1_PARDP Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=ssuB1 PE=3 SV=1 1285 1485 1.0E-11
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 525 714 1.0E-11
sp|Q578K3|FBPC_BRUAB Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus biovar 1 (strain 9-941) GN=fbpC PE=3 SV=1 526 720 1.0E-11
sp|Q2YKX3|FBPC_BRUA2 Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus (strain 2308) GN=fbpC PE=3 SV=1 526 720 1.0E-11
sp|Q92WJ0|FBPC1_RHIME Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhizobium meliloti (strain 1021) GN=fbpC1 PE=3 SV=1 526 720 1.0E-11
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 526 718 2.0E-11
sp|Q8Y8T6|POTA_LISMO Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=potA PE=3 SV=2 527 718 2.0E-11
sp|Q722B1|POTA_LISMF Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=potA PE=3 SV=2 527 718 2.0E-11
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 1283 1493 2.0E-11
sp|Q63S19|METN1_BURPS Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain K96243) GN=metN1 PE=3 SV=1 524 718 2.0E-11
sp|Q3JPZ4|METN1_BURP1 Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain 1710b) GN=metN1 PE=3 SV=1 524 718 2.0E-11
sp|Q62M41|METN1_BURMA Methionine import ATP-binding protein MetN 1 OS=Burkholderia mallei (strain ATCC 23344) GN=metN1 PE=3 SV=1 524 718 2.0E-11
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 519 718 2.0E-11
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 519 718 2.0E-11
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 526 718 2.0E-11
sp|Q8FVV5|FBPC_BRUSU Fe(3+) ions import ATP-binding protein FbpC OS=Brucella suis biovar 1 (strain 1330) GN=fbpC PE=3 SV=1 526 720 2.0E-11
sp|Q9KTJ5|METN_VIBCH Methionine import ATP-binding protein MetN OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=metN PE=3 SV=1 1297 1485 2.0E-11
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 526 760 3.0E-11
sp|Q87PH3|POTA_VIBPA Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=potA PE=3 SV=1 516 720 3.0E-11
sp|Q24XJ2|POTA_DESHY Spermidine/putrescine import ATP-binding protein PotA OS=Desulfitobacterium hafniense (strain Y51) GN=potA PE=3 SV=2 518 718 3.0E-11
sp|Q7MPC5|THIQ_VIBVY Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain YJ016) GN=thiQ PE=3 SV=1 1305 1504 3.0E-11
sp|Q8DE95|THIQ_VIBVU Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain CMCP6) GN=thiQ PE=3 SV=1 1305 1504 3.0E-11
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 537 689 3.0E-11
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 537 689 3.0E-11
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 527 721 3.0E-11
sp|Q7MKU3|POTA_VIBVY Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain YJ016) GN=potA PE=3 SV=2 518 720 4.0E-11
sp|Q8D9J4|POTA_VIBVU Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain CMCP6) GN=potA PE=3 SV=1 518 720 4.0E-11
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 526 722 4.0E-11
sp|O34338|MNTB_BACSU Manganese transport system ATP-binding protein MntB OS=Bacillus subtilis (strain 168) GN=mntB PE=3 SV=1 527 724 4.0E-11
sp|Q0T7M2|TAUB_SHIF8 Taurine import ATP-binding protein TauB OS=Shigella flexneri serotype 5b (strain 8401) GN=tauB PE=3 SV=1 526 707 4.0E-11
sp|A0AGP9|POTA_LISW6 Spermidine/putrescine import ATP-binding protein PotA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=potA PE=3 SV=1 527 718 5.0E-11
sp|P15031|FECE_ECOLI Fe(3+) dicitrate transport ATP-binding protein FecE OS=Escherichia coli (strain K12) GN=fecE PE=2 SV=1 526 718 5.0E-11
sp|Q92DL6|POTA_LISIN Spermidine/putrescine import ATP-binding protein PotA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=potA PE=3 SV=2 527 718 6.0E-11
sp|Q1B677|METN_MYCSS Methionine import ATP-binding protein MetN OS=Mycobacterium sp. (strain MCS) GN=metN PE=3 SV=2 527 718 6.0E-11
sp|Q3KBH4|POTA_PSEPF Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf0-1) GN=potA PE=3 SV=1 526 721 6.0E-11
sp|Q6GIH9|METN2_STAAR Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MRSA252) GN=metN2 PE=3 SV=1 1297 1472 8.0E-11
sp|Q31DV4|PHNC_THICR Phosphonates import ATP-binding protein PhnC OS=Thiomicrospira crunogena (strain XCL-2) GN=phnC PE=3 SV=1 526 720 8.0E-11
sp|Q5E586|POTA_VIBF1 Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=potA PE=3 SV=1 518 720 8.0E-11
sp|Q8XIZ5|POTA_CLOPE Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain 13 / Type A) GN=potA PE=3 SV=1 527 770 9.0E-11
sp|Q0TNZ3|POTA_CLOP1 Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=potA PE=3 SV=1 527 770 9.0E-11
sp|Q4L4R9|METN_STAHJ Methionine import ATP-binding protein MetN OS=Staphylococcus haemolyticus (strain JCSC1435) GN=metN PE=3 SV=1 1297 1472 9.0E-11
sp|Q0SRL2|POTA_CLOPS Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain SM101 / Type A) GN=potA PE=3 SV=2 527 714 1.0E-10
sp|Q30V33|POTA_DESAG Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio alaskensis (strain G20) GN=potA PE=3 SV=1 518 729 1.0E-10
sp|Q98HF7|POTA_RHILO Spermidine/putrescine import ATP-binding protein PotA OS=Rhizobium loti (strain MAFF303099) GN=potA PE=3 SV=1 524 721 1.0E-10
sp|Q9TKX3|CYSA_NEPOL Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1 526 720 1.0E-10
sp|Q8NXH5|METN2_STAAW Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MW2) GN=metN2 PE=3 SV=1 1297 1472 1.0E-10
sp|Q6GB18|METN2_STAAS Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MSSA476) GN=metN2 PE=3 SV=1 1297 1472 1.0E-10
sp|Q5HHK4|METN2_STAAC Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain COL) GN=metN2 PE=3 SV=1 1297 1472 1.0E-10
sp|Q2FZZ2|METN2_STAA8 Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN2 PE=3 SV=1 1297 1472 1.0E-10
sp|Q2FII2|METN2_STAA3 Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain USA300) GN=metN2 PE=3 SV=1 1297 1472 1.0E-10
sp|Q92G36|ZNUC_RICCN Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1 527 691 1.0E-10
sp|Q7A6M2|METN2_STAAN Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain N315) GN=metN2 PE=1 SV=1 1297 1472 1.0E-10
sp|Q99VG8|METN2_STAAM Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metN2 PE=1 SV=1 1297 1472 1.0E-10
sp|Q2YWP2|METN2_STAAB Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metN2 PE=3 SV=1 1297 1472 1.0E-10
sp|Q4W575|FBPC_NEIMB Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbpC PE=3 SV=1 518 718 1.0E-10
sp|Q9JVH1|FBPC_NEIMA Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbpC PE=3 SV=1 518 718 1.0E-10
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 527 718 1.0E-10
sp|Q6F9P2|METN2_ACIAD Methionine import ATP-binding protein MetN 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN2 PE=3 SV=1 1297 1485 1.0E-10
sp|Q9A7X1|CYSA_CAUCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cysA PE=3 SV=2 526 714 2.0E-10
sp|Q9KS33|POTA_VIBCH Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=potA PE=3 SV=1 518 720 2.0E-10
sp|A3DDF6|POTA_CLOTH Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=potA PE=3 SV=1 518 714 2.0E-10
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 523 713 2.0E-10
sp|Q87AL9|METN_XYLFT Methionine import ATP-binding protein MetN OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metN PE=3 SV=1 524 713 2.0E-10
sp|Q88ZJ6|POTA_LACPL Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=potA PE=3 SV=1 527 718 3.0E-10
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 526 721 3.0E-10
sp|Q5FKL2|METN_LACAC Methionine import ATP-binding protein MetN OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=metN PE=3 SV=1 1297 1514 3.0E-10
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 526 721 3.0E-10
sp|Q2KVK2|METN_BORA1 Methionine import ATP-binding protein MetN OS=Bordetella avium (strain 197N) GN=metN PE=3 SV=1 526 709 3.0E-10
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 527 691 3.0E-10
sp|Q68Y13|ZNUC_RICTY Zinc import ATP-binding protein ZnuC OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=znuC PE=3 SV=1 536 675 3.0E-10
sp|P26946|Y2279_BACPE Uncharacterized ABC transporter ATP-binding protein BpOF4_11395 OS=Bacillus pseudofirmus (strain OF4) GN=BpOF4_11395 PE=3 SV=2 1313 1500 4.0E-10
sp|P30769|MKL_MYCLE Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium leprae (strain TN) GN=mkl PE=3 SV=2 530 709 4.0E-10
sp|Q03ZL5|ECFA2_LEUMM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ecfA2 PE=1 SV=1 1300 1479 5.0E-10
sp|P77795|YDCT_ECOLI Uncharacterized ABC transporter ATP-binding protein YdcT OS=Escherichia coli (strain K12) GN=ydcT PE=3 SV=1 524 721 5.0E-10
sp|P9WQL5|MKL_MYCTU Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mkl PE=1 SV=1 530 709 5.0E-10
sp|P9WQL4|MKL_MYCTO Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mkl PE=3 SV=1 530 709 5.0E-10
sp|P63358|MKL_MYCBO Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mkl PE=3 SV=1 530 709 5.0E-10
sp|Q13KX9|TAUB2_BURXL Taurine import ATP-binding protein TauB 2 OS=Burkholderia xenovorans (strain LB400) GN=tauB2 PE=3 SV=1 517 705 6.0E-10
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 524 715 7.0E-10
sp|Q9ZCC4|ZNUC_RICPR Zinc import ATP-binding protein ZnuC OS=Rickettsia prowazekii (strain Madrid E) GN=znuC PE=3 SV=1 536 675 7.0E-10
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 530 721 1.0E-09
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 526 721 1.0E-09
sp|Q7MN25|METN_VIBVY Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain YJ016) GN=metN PE=3 SV=1 1297 1486 1.0E-09
sp|Q8DFC3|METN_VIBVU Methionine import ATP-binding protein MetN OS=Vibrio vulnificus (strain CMCP6) GN=metN PE=3 SV=1 1297 1486 1.0E-09
sp|Q6LR20|POTA_PHOPR Spermidine/putrescine import ATP-binding protein PotA OS=Photobacterium profundum GN=potA PE=3 SV=1 516 720 1.0E-09
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 537 713 3.0E-09
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 518 713 3.0E-09
sp|Q8PGE8|METN_XANAC Methionine import ATP-binding protein MetN OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metN PE=3 SV=1 510 718 4.0E-09
sp|Q18CI9|ECFA2_PEPD6 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Peptoclostridium difficile (strain 630) GN=ecfA2 PE=3 SV=1 540 718 5.0E-09
sp|Q6D5H7|METN1_PECAS Methionine import ATP-binding protein MetN 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN1 PE=3 SV=1 526 714 6.0E-09
sp|Q8P4S7|METN_XANCP Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=metN PE=3 SV=1 524 718 8.0E-09
sp|Q4UQD2|METN_XANC8 Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. campestris (strain 8004) GN=metN PE=3 SV=1 524 718 8.0E-09
sp|Q8U4K3|WTPC_PYRFU Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1 530 722 1.0E-08
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 526 743 2.0E-08
sp|P55604|Y4OS_RHISN Uncharacterized ABC transporter ATP-binding protein y4oS OS=Rhizobium sp. (strain NGR234) GN=NGR_a02170 PE=3 SV=1 530 721 2.0E-08
sp|Q9KD30|MNTB_BACHD Manganese transport system ATP-binding protein MntB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mntB PE=3 SV=1 526 706 2.0E-08
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 542 722 3.0E-08
sp|Q9RKC6|Y3161_STRCO Putative ABC transporter ATP-binding protein SCO3161 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3161 PE=3 SV=1 526 736 4.0E-08
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 527 707 4.0E-08
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 525 720 6.0E-08
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 537 718 6.0E-08
sp|Q8DU24|PSTB1_STRMU Phosphate import ATP-binding protein PstB 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pstB1 PE=3 SV=1 521 718 6.0E-08
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 510 724 7.0E-08
sp|Q74L62|ECFA1_LACJO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=ecfA1 PE=3 SV=1 1297 1498 1.0E-07
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 529 689 1.0E-07
sp|Q8RGC8|FBPC_FUSNN Fe(3+) ions import ATP-binding protein FbpC OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fbpC PE=3 SV=1 525 721 2.0E-07
sp|Q659V4|HMUV_PHODD Hemin import ATP-binding protein HmuV OS=Photobacterium damselae subsp. damselae GN=hmuV PE=3 SV=1 527 714 3.0E-07
sp|Q70GD4|HMUV_PHODP Hemin import ATP-binding protein HmuV OS=Photobacterium damsela subsp. piscicida GN=hmuV PE=3 SV=1 527 714 3.0E-07
sp|A5U7B7|FTSE_MYCTA Cell division ATP-binding protein FtsE OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ftsE PE=1 SV=1 526 709 3.0E-07
sp|O05779|FTSE_MYCTU Cell division ATP-binding protein FtsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsE PE=1 SV=2 526 709 4.0E-07
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 523 714 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016887 ATP hydrolysis activity Yes
GO:0005524 ATP binding Yes
GO:0043168 anion binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016462 pyrophosphatase activity No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 252 274 22
3 310 332 22
4 337 359 22
5 369 386 17
6 393 415 22
7 435 457 22
8 851 873 22
9 1029 1051 22
10 1072 1094 22
11 1109 1131 22
12 1136 1158 22
13 1173 1195 22
14 1216 1238 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2500
MIAKRPARFLVLRQIWTLTSKDLRCLLRRHGLLMASVAFVMPLLLAGFFTFAKNLFLPPAKYGVGISRPILTLRE
AVEIAHGNGHDKLILVDGPAGSGGEQNMSRLLDIITEETQSYRSPIRTVRISTESDLASHCRSTLRGVTRCLGAV
VMRGAPPAGPWNYTIRTDALVASGSQLIKVQEGRNVEQVFVLPLQRAVDSAIATIEAGSDADNNNNNNNNNNNPL
GVANEWPFTSRTQAEYDDKTRKQYLDAIVNFMGVAFVTTIISVTYQLAGAVATDRESGIARLIDAMLPGCRPGAA
QVTRIAAHHLAYTILYAPAWIVAALIVRFGIFVYTSLAVVILLQLLGGLAFVSFSILCASFFNRAQLSSASATLA
AFLLAILAQSLTSPATVTVAVLSALFAPCNYVYFITLMARFERLNRPTSLIDMPPGESPWAVPGLALWLLLCLQI
VAYPLLAAWVERWRFGTPADGRRYARAGQPNPSLDGDVAVRLDGLTKVYYPALLPRLAAFFRCCGAGSQSTEPVV
AVNGLNLSCPRGQIVTLLGANGSGKSTTLNAIAGLHQPTSGSISVDGTGGLGIAPQKNVMWDDVTVQDHLDIFGR
LKSPARPPTTEETEELVRSIDLWTKRRALAKTLSGGQKRKLQLGMMLAGGSAVCCVDEVSSGLDPISRRKIWDIL
LAERGRRTLILTTHFLDEADLLADHMAILSRGTLRAAGSSVELKERFGGGYRVRVPAGAGPEVQGVERKEAADGT
TYAAPTSDLAARVIRRLDSGGVADYHFSSPTIEDVFLRLVEEVEVDRVSHPPPSTETKTAGDDKLSREDRPPLKL
MDGSVVGNGRQMLVLLRKRATVFKRNWVLYMVAFLLPVLAAVLTSMYVRGKDPTGCSSPRYKTVEDAMSRMTKEN
YKPRLVMGPSSSLDRTELLRVLTPLFNDTRHRLRHGPDDSGGLQMDTEQVRWAKTYDEFSGFVTGGWRNLTAGVW
LGDESSPPTMAWLANKAILVPLIAQQLLDSLQARKTILTSWLPFDVPFDPAVGSVLNLVVYMALALIFFPAFFGL
YPSSERTSGVRALQYSNGVRPLPLWAAYAAFDMMFVLATAALVTALWAVLAHSWYHLGFIFVVLALYGLASTEFA
YLVSLSARSQLASFAWTVVLQCIVFLVYLITYVCVLTYVSVDRVDGALFISHLVLSALAPIGSVVRSLFIATNLF
STACDGRKLSSRPAGLALYGGPILYLSVQCVLLFGLLVWFDGGSAMRRGRGSKLDSREDGYGAEGNKAGVGHLDG
TGAGDEGLRVANLTKSFGRNTAVDNVSFGVGRGEVFALLGPNGAGKSTTMALIRGDERPSRNGGDVFVGPASVTR
NRAAARALLGVCPQMDALDSFMTVREHLDFYARVRGVPDADHNVQAVLVAVGLEGLSSRMATALSGGNKRKLSLA
MALMGNPAVVLLDEPSSGLDAAAKRILWPVLASAAAGRSILLTTHSMEEADALAARAGILARRMLALGSLDELRR
RAGHRLHVHLVAASAPRTTPAQMARMADWVRVAMPEAELEPETYHGQMRFAVRAKDVAAAGTNLRRHYHHHHHHD
GHRHHHHQHRRRRRRQQQQQQQQQKKNPPFSSLEDEEDKDVTVVVREEHLAESELESASSDPDSASSSHDQTDSN
QQSCYSRSCSCPAATTAPQDDDDGGGGGGALGRLVVLLDRHKSRLGVQHYSVSPTTLDQVFLAIVGADNGRELER
PRPAFWSLVREWARAA
Coding >Ophio5|2500
ATGATTGCCAAGCGGCCGGCTAGGTTTCTCGTGCTCCGCCAGATATGGACGCTCACGTCAAAGGACCTTCGATGC
CTTCTCCGACGACATGGACTGCTCATGGCCAGCGTGGCCTTTGTGATGCCCTTGCTCCTGGCGGGCTTCTTTACC
TTTGCCAAGAACCTATTCCTGCCACCGGCAAAGTATGGCGTCGGCATCTCGCGGCCCATTTTAACGCTGCGAGAA
GCGGTCGAGATAGCGCACGGCAACGGACATGATAAGCTGATCCTAGTGGACGGGCCGGCCGGTTCAGGCGGCGAG
CAAAACATGTCGAGGCTACTCGACATCATCACCGAGGAGACGCAGTCGTACAGGTCGCCGATACGAACGGTGCGC
ATCTCCACTGAGTCCGACCTGGCATCGCACTGCCGCAGCACGCTGAGGGGCGTGACGCGCTGTTTGGGCGCCGTC
GTGATGCGAGGAGCGCCGCCAGCAGGGCCTTGGAACTACACGATTCGAACTGACGCCTTGGTGGCTTCCGGCTCG
CAGTTGATCAAGGTCCAGGAAGGGAGAAACGTCGAGCAGGTGTTTGTGCTGCCTCTGCAACGGGCTGTTGACTCT
GCCATTGCGACCATAGAAGCCGGCAGCGATGCCGACAACAACAACAACAACAACAACAACAACAACAATCCCCTG
GGCGTGGCCAACGAGTGGCCTTTTACCAGTCGTACGCAGGCCGAGTATGACGACAAGACGCGGAAGCAGTATCTC
GACGCCATCGTCAACTTCATGGGCGTCGCCTTCGTCACTACCATCATCAGCGTCACCTATCAACTCGCCGGCGCC
GTGGCCACGGACCGTGAGTCCGGCATAGCACGCCTCATCGACGCCATGTTGCCCGGATGCCGACCCGGCGCTGCT
CAGGTGACGCGTATCGCGGCTCATCACCTGGCTTACACGATTCTGTACGCGCCGGCGTGGATCGTGGCCGCCCTC
ATCGTCCGCTTCGGCATCTTCGTCTACACGTCGCTCGCCGTCGTCATCCTCTTGCAACTGCTGGGCGGTCTGGCC
TTTGTCTCCTTTTCCATCCTGTGCGCCAGCTTCTTTAACCGGGCCCAGCTAAGCAGTGCCAGTGCCACGCTCGCC
GCCTTTTTGCTGGCTATACTCGCCCAGTCGTTGACGTCGCCGGCAACCGTGACCGTCGCGGTGCTGTCTGCCCTG
TTCGCGCCCTGCAACTACGTCTACTTCATCACGCTTATGGCTCGCTTCGAGCGCCTGAATCGCCCGACAAGTCTC
ATCGATATGCCTCCCGGCGAGAGCCCCTGGGCGGTGCCGGGCTTGGCTTTGTGGTTGCTTCTTTGCCTGCAAATC
GTAGCTTACCCCCTGCTGGCGGCCTGGGTCGAGCGTTGGCGCTTCGGAACCCCGGCCGACGGGAGACGTTATGCC
CGAGCCGGTCAGCCGAATCCGAGCTTGGACGGTGATGTCGCCGTCCGGCTCGATGGCCTGACCAAGGTCTATTAC
CCGGCCCTGCTTCCGCGCCTCGCCGCCTTCTTCCGCTGCTGCGGCGCCGGAAGCCAGTCGACCGAGCCAGTCGTG
GCCGTCAACGGGCTCAATCTCAGCTGTCCGCGAGGCCAGATCGTCACTCTTCTCGGGGCCAACGGCAGCGGCAAG
AGCACAACACTCAATGCCATCGCCGGCCTTCATCAGCCGACGAGCGGCTCCATCTCGGTCGACGGCACGGGCGGA
CTCGGTATCGCGCCGCAGAAGAACGTGATGTGGGACGACGTGACGGTACAGGACCATCTGGACATCTTTGGACGG
CTCAAGTCGCCGGCGAGGCCGCCAACGACGGAGGAGACGGAAGAGCTCGTCCGGTCCATCGACCTATGGACGAAG
CGGAGGGCACTGGCCAAGACGCTCTCTGGAGGACAGAAGCGCAAGCTACAACTGGGCATGATGCTGGCGGGCGGC
AGCGCCGTGTGCTGCGTCGACGAGGTCAGCAGCGGCCTGGATCCCATCTCTCGACGCAAGATCTGGGACATTTTG
CTGGCCGAACGCGGCCGACGTACGTTGATCCTGACGACACACTTTCTCGACGAGGCCGATCTCCTGGCGGACCAC
ATGGCCATCCTCTCACGCGGCACCCTCCGGGCCGCCGGCTCCTCGGTCGAGCTCAAGGAACGCTTCGGAGGCGGC
TACCGCGTCCGCGTCCCGGCCGGAGCCGGGCCTGAAGTCCAGGGCGTGGAGCGCAAGGAGGCGGCCGACGGGACG
ACGTACGCGGCGCCTACTTCGGACCTGGCGGCGAGGGTGATACGGCGGCTCGACTCCGGCGGCGTGGCCGATTAT
CACTTTTCCAGCCCGACTATCGAGGACGTCTTCTTGCGGCTGGTTGAGGAGGTCGAGGTTGATCGAGTCTCACAC
CCGCCGCCATCAACCGAAACCAAGACGGCCGGCGACGACAAGTTATCCCGGGAAGACCGGCCGCCGCTCAAGCTC
ATGGACGGCTCCGTCGTCGGAAACGGACGGCAGATGCTCGTGCTGTTGCGGAAGAGGGCGACCGTCTTTAAGCGC
AACTGGGTTCTCTACATGGTGGCCTTTCTACTGCCCGTCCTGGCGGCGGTGCTGACATCCATGTACGTCCGCGGA
AAGGATCCCACCGGGTGCAGCTCGCCGCGATATAAGACAGTCGAGGACGCCATGAGCCGGATGACGAAAGAGAAT
TACAAGCCCAGGCTGGTCATGGGACCGTCGTCGAGTCTGGATCGGACGGAACTACTCCGCGTGCTGACGCCCCTA
TTCAATGACACCCGCCATAGGCTCCGACACGGCCCCGACGACAGCGGCGGGCTGCAGATGGATACGGAGCAGGTC
AGATGGGCCAAGACGTACGACGAATTCAGCGGCTTCGTGACGGGCGGATGGAGGAACCTTACAGCCGGCGTCTGG
CTGGGCGACGAGTCCTCACCGCCGACCATGGCCTGGCTGGCCAACAAGGCCATCTTGGTGCCTCTGATAGCGCAG
CAGCTTCTCGACTCGCTTCAGGCCCGAAAGACGATCCTGACGTCGTGGCTGCCCTTTGACGTGCCCTTCGACCCG
GCCGTCGGCTCCGTTCTCAACCTGGTCGTCTACATGGCACTGGCCCTCATCTTCTTCCCGGCCTTCTTCGGCCTC
TATCCCAGCAGCGAGCGCACGAGCGGCGTACGGGCACTGCAGTACTCCAACGGCGTGAGACCTCTCCCGCTGTGG
GCTGCGTACGCGGCCTTTGATATGATGTTTGTCCTGGCTACTGCCGCGCTGGTGACGGCTCTCTGGGCCGTCTTG
GCCCACTCCTGGTATCACCTCGGCTTCATATTCGTCGTTCTGGCGCTATACGGACTGGCTTCGACGGAATTCGCC
TATCTGGTCTCGCTGTCTGCTCGGTCGCAGCTGGCGAGCTTCGCGTGGACCGTCGTATTGCAGTGCATTGTCTTC
CTCGTCTACCTCATCACCTACGTGTGCGTCTTGACGTACGTCAGTGTCGATCGGGTGGACGGAGCCCTTTTCATC
TCTCACCTCGTGCTATCGGCCCTTGCACCCATCGGCTCCGTCGTTCGCTCGCTCTTCATCGCCACCAACTTATTC
TCGACGGCCTGCGACGGGAGGAAGCTGTCGAGCCGGCCGGCCGGCTTGGCCCTGTACGGCGGTCCGATCCTCTAT
CTTTCGGTGCAGTGCGTCTTGCTGTTCGGCCTGCTCGTCTGGTTCGATGGCGGTTCGGCAATGCGCCGGGGCCGC
GGTTCGAAGCTGGACAGTCGAGAGGACGGTTATGGCGCCGAAGGCAACAAGGCCGGAGTGGGCCACCTCGACGGA
ACCGGAGCCGGAGACGAGGGGCTCCGGGTCGCGAATCTGACCAAATCGTTCGGACGCAACACGGCCGTCGACAAC
GTCTCGTTCGGCGTTGGTCGCGGCGAGGTCTTTGCGCTGCTGGGTCCCAACGGAGCCGGTAAATCGACAACCATG
GCCCTGATCCGCGGAGACGAGCGTCCGAGCCGGAACGGGGGCGACGTCTTCGTCGGCCCGGCCTCGGTCACGCGC
AACCGAGCCGCAGCGCGAGCCCTTCTCGGCGTATGCCCACAGATGGACGCTCTGGATTCCTTCATGACGGTACGA
GAACATCTCGACTTCTACGCCCGCGTCCGAGGCGTGCCAGACGCGGACCACAACGTCCAAGCCGTCCTGGTCGCC
GTCGGCCTCGAAGGCCTATCGTCGCGAATGGCGACGGCGCTCTCGGGCGGAAACAAGCGGAAGCTCAGCCTGGCC
ATGGCGCTGATGGGGAACCCCGCCGTCGTCCTCCTGGACGAGCCGTCTTCCGGTCTCGACGCGGCGGCCAAGCGG
ATCCTGTGGCCGGTTTTGGCCTCGGCCGCCGCCGGGCGCTCTATCCTTCTCACGACGCATAGCATGGAGGAGGCT
GACGCTCTGGCAGCCCGGGCCGGCATCCTCGCTCGTCGGATGCTCGCGTTGGGGTCGTTGGACGAGTTGCGTCGG
AGGGCTGGTCATCGTCTTCATGTTCATCTCGTCGCTGCTTCGGCGCCTCGGACGACGCCGGCGCAGATGGCGAGG
ATGGCCGACTGGGTTCGTGTCGCTATGCCCGAGGCTGAGCTCGAGCCGGAGACGTATCACGGTCAGATGCGGTTT
GCTGTTCGCGCCAAGGACGTGGCCGCTGCCGGAACCAATCTACGTCGTCACTACCACCACCACCACCACCACGAC
GGTCATCGTCATCATCATCATCAACATCGTCGTCGTCGTCGTCGTCAACAACAACAACAACAACAACAACAAAAA
AAAAACCCGCCCTTCTCCTCCCTCGAAGACGAAGAGGACAAAGACGTGACCGTCGTCGTCCGCGAGGAGCACCTG
GCCGAATCCGAGCTCGAATCCGCCTCTTCCGACCCCGACTCGGCTTCCTCGTCCCATGACCAGACCGACAGCAAC
CAGCAGTCTTGTTATTCTCGTTCTTGTTCTTGTCCGGCCGCCACCACCGCTCCCCAAGACGACGACGACGGCGGT
GGCGGCGGTGGCGCCCTAGGCCGCCTCGTCGTCCTCCTCGACCGTCACAAGTCCCGGCTCGGCGTCCAGCACTAT
AGCGTCAGCCCTACCACGCTCGATCAGGTCTTTCTCGCCATCGTCGGCGCCGACAACGGCCGAGAGTTGGAGAGG
CCCCGGCCTGCTTTTTGGTCTTTGGTGCGGGAGTGGGCGCGGGCCGCT
Transcript >Ophio5|2500
ATGATTGCCAAGCGGCCGGCTAGGTTTCTCGTGCTCCGCCAGATATGGACGCTCACGTCAAAGGACCTTCGATGC
CTTCTCCGACGACATGGACTGCTCATGGCCAGCGTGGCCTTTGTGATGCCCTTGCTCCTGGCGGGCTTCTTTACC
TTTGCCAAGAACCTATTCCTGCCACCGGCAAAGTATGGCGTCGGCATCTCGCGGCCCATTTTAACGCTGCGAGAA
GCGGTCGAGATAGCGCACGGCAACGGACATGATAAGCTGATCCTAGTGGACGGGCCGGCCGGTTCAGGCGGCGAG
CAAAACATGTCGAGGCTACTCGACATCATCACCGAGGAGACGCAGTCGTACAGGTCGCCGATACGAACGGTGCGC
ATCTCCACTGAGTCCGACCTGGCATCGCACTGCCGCAGCACGCTGAGGGGCGTGACGCGCTGTTTGGGCGCCGTC
GTGATGCGAGGAGCGCCGCCAGCAGGGCCTTGGAACTACACGATTCGAACTGACGCCTTGGTGGCTTCCGGCTCG
CAGTTGATCAAGGTCCAGGAAGGGAGAAACGTCGAGCAGGTGTTTGTGCTGCCTCTGCAACGGGCTGTTGACTCT
GCCATTGCGACCATAGAAGCCGGCAGCGATGCCGACAACAACAACAACAACAACAACAACAACAACAATCCCCTG
GGCGTGGCCAACGAGTGGCCTTTTACCAGTCGTACGCAGGCCGAGTATGACGACAAGACGCGGAAGCAGTATCTC
GACGCCATCGTCAACTTCATGGGCGTCGCCTTCGTCACTACCATCATCAGCGTCACCTATCAACTCGCCGGCGCC
GTGGCCACGGACCGTGAGTCCGGCATAGCACGCCTCATCGACGCCATGTTGCCCGGATGCCGACCCGGCGCTGCT
CAGGTGACGCGTATCGCGGCTCATCACCTGGCTTACACGATTCTGTACGCGCCGGCGTGGATCGTGGCCGCCCTC
ATCGTCCGCTTCGGCATCTTCGTCTACACGTCGCTCGCCGTCGTCATCCTCTTGCAACTGCTGGGCGGTCTGGCC
TTTGTCTCCTTTTCCATCCTGTGCGCCAGCTTCTTTAACCGGGCCCAGCTAAGCAGTGCCAGTGCCACGCTCGCC
GCCTTTTTGCTGGCTATACTCGCCCAGTCGTTGACGTCGCCGGCAACCGTGACCGTCGCGGTGCTGTCTGCCCTG
TTCGCGCCCTGCAACTACGTCTACTTCATCACGCTTATGGCTCGCTTCGAGCGCCTGAATCGCCCGACAAGTCTC
ATCGATATGCCTCCCGGCGAGAGCCCCTGGGCGGTGCCGGGCTTGGCTTTGTGGTTGCTTCTTTGCCTGCAAATC
GTAGCTTACCCCCTGCTGGCGGCCTGGGTCGAGCGTTGGCGCTTCGGAACCCCGGCCGACGGGAGACGTTATGCC
CGAGCCGGTCAGCCGAATCCGAGCTTGGACGGTGATGTCGCCGTCCGGCTCGATGGCCTGACCAAGGTCTATTAC
CCGGCCCTGCTTCCGCGCCTCGCCGCCTTCTTCCGCTGCTGCGGCGCCGGAAGCCAGTCGACCGAGCCAGTCGTG
GCCGTCAACGGGCTCAATCTCAGCTGTCCGCGAGGCCAGATCGTCACTCTTCTCGGGGCCAACGGCAGCGGCAAG
AGCACAACACTCAATGCCATCGCCGGCCTTCATCAGCCGACGAGCGGCTCCATCTCGGTCGACGGCACGGGCGGA
CTCGGTATCGCGCCGCAGAAGAACGTGATGTGGGACGACGTGACGGTACAGGACCATCTGGACATCTTTGGACGG
CTCAAGTCGCCGGCGAGGCCGCCAACGACGGAGGAGACGGAAGAGCTCGTCCGGTCCATCGACCTATGGACGAAG
CGGAGGGCACTGGCCAAGACGCTCTCTGGAGGACAGAAGCGCAAGCTACAACTGGGCATGATGCTGGCGGGCGGC
AGCGCCGTGTGCTGCGTCGACGAGGTCAGCAGCGGCCTGGATCCCATCTCTCGACGCAAGATCTGGGACATTTTG
CTGGCCGAACGCGGCCGACGTACGTTGATCCTGACGACACACTTTCTCGACGAGGCCGATCTCCTGGCGGACCAC
ATGGCCATCCTCTCACGCGGCACCCTCCGGGCCGCCGGCTCCTCGGTCGAGCTCAAGGAACGCTTCGGAGGCGGC
TACCGCGTCCGCGTCCCGGCCGGAGCCGGGCCTGAAGTCCAGGGCGTGGAGCGCAAGGAGGCGGCCGACGGGACG
ACGTACGCGGCGCCTACTTCGGACCTGGCGGCGAGGGTGATACGGCGGCTCGACTCCGGCGGCGTGGCCGATTAT
CACTTTTCCAGCCCGACTATCGAGGACGTCTTCTTGCGGCTGGTTGAGGAGGTCGAGGTTGATCGAGTCTCACAC
CCGCCGCCATCAACCGAAACCAAGACGGCCGGCGACGACAAGTTATCCCGGGAAGACCGGCCGCCGCTCAAGCTC
ATGGACGGCTCCGTCGTCGGAAACGGACGGCAGATGCTCGTGCTGTTGCGGAAGAGGGCGACCGTCTTTAAGCGC
AACTGGGTTCTCTACATGGTGGCCTTTCTACTGCCCGTCCTGGCGGCGGTGCTGACATCCATGTACGTCCGCGGA
AAGGATCCCACCGGGTGCAGCTCGCCGCGATATAAGACAGTCGAGGACGCCATGAGCCGGATGACGAAAGAGAAT
TACAAGCCCAGGCTGGTCATGGGACCGTCGTCGAGTCTGGATCGGACGGAACTACTCCGCGTGCTGACGCCCCTA
TTCAATGACACCCGCCATAGGCTCCGACACGGCCCCGACGACAGCGGCGGGCTGCAGATGGATACGGAGCAGGTC
AGATGGGCCAAGACGTACGACGAATTCAGCGGCTTCGTGACGGGCGGATGGAGGAACCTTACAGCCGGCGTCTGG
CTGGGCGACGAGTCCTCACCGCCGACCATGGCCTGGCTGGCCAACAAGGCCATCTTGGTGCCTCTGATAGCGCAG
CAGCTTCTCGACTCGCTTCAGGCCCGAAAGACGATCCTGACGTCGTGGCTGCCCTTTGACGTGCCCTTCGACCCG
GCCGTCGGCTCCGTTCTCAACCTGGTCGTCTACATGGCACTGGCCCTCATCTTCTTCCCGGCCTTCTTCGGCCTC
TATCCCAGCAGCGAGCGCACGAGCGGCGTACGGGCACTGCAGTACTCCAACGGCGTGAGACCTCTCCCGCTGTGG
GCTGCGTACGCGGCCTTTGATATGATGTTTGTCCTGGCTACTGCCGCGCTGGTGACGGCTCTCTGGGCCGTCTTG
GCCCACTCCTGGTATCACCTCGGCTTCATATTCGTCGTTCTGGCGCTATACGGACTGGCTTCGACGGAATTCGCC
TATCTGGTCTCGCTGTCTGCTCGGTCGCAGCTGGCGAGCTTCGCGTGGACCGTCGTATTGCAGTGCATTGTCTTC
CTCGTCTACCTCATCACCTACGTGTGCGTCTTGACGTACGTCAGTGTCGATCGGGTGGACGGAGCCCTTTTCATC
TCTCACCTCGTGCTATCGGCCCTTGCACCCATCGGCTCCGTCGTTCGCTCGCTCTTCATCGCCACCAACTTATTC
TCGACGGCCTGCGACGGGAGGAAGCTGTCGAGCCGGCCGGCCGGCTTGGCCCTGTACGGCGGTCCGATCCTCTAT
CTTTCGGTGCAGTGCGTCTTGCTGTTCGGCCTGCTCGTCTGGTTCGATGGCGGTTCGGCAATGCGCCGGGGCCGC
GGTTCGAAGCTGGACAGTCGAGAGGACGGTTATGGCGCCGAAGGCAACAAGGCCGGAGTGGGCCACCTCGACGGA
ACCGGAGCCGGAGACGAGGGGCTCCGGGTCGCGAATCTGACCAAATCGTTCGGACGCAACACGGCCGTCGACAAC
GTCTCGTTCGGCGTTGGTCGCGGCGAGGTCTTTGCGCTGCTGGGTCCCAACGGAGCCGGTAAATCGACAACCATG
GCCCTGATCCGCGGAGACGAGCGTCCGAGCCGGAACGGGGGCGACGTCTTCGTCGGCCCGGCCTCGGTCACGCGC
AACCGAGCCGCAGCGCGAGCCCTTCTCGGCGTATGCCCACAGATGGACGCTCTGGATTCCTTCATGACGGTACGA
GAACATCTCGACTTCTACGCCCGCGTCCGAGGCGTGCCAGACGCGGACCACAACGTCCAAGCCGTCCTGGTCGCC
GTCGGCCTCGAAGGCCTATCGTCGCGAATGGCGACGGCGCTCTCGGGCGGAAACAAGCGGAAGCTCAGCCTGGCC
ATGGCGCTGATGGGGAACCCCGCCGTCGTCCTCCTGGACGAGCCGTCTTCCGGTCTCGACGCGGCGGCCAAGCGG
ATCCTGTGGCCGGTTTTGGCCTCGGCCGCCGCCGGGCGCTCTATCCTTCTCACGACGCATAGCATGGAGGAGGCT
GACGCTCTGGCAGCCCGGGCCGGCATCCTCGCTCGTCGGATGCTCGCGTTGGGGTCGTTGGACGAGTTGCGTCGG
AGGGCTGGTCATCGTCTTCATGTTCATCTCGTCGCTGCTTCGGCGCCTCGGACGACGCCGGCGCAGATGGCGAGG
ATGGCCGACTGGGTTCGTGTCGCTATGCCCGAGGCTGAGCTCGAGCCGGAGACGTATCACGGTCAGATGCGGTTT
GCTGTTCGCGCCAAGGACGTGGCCGCTGCCGGAACCAATCTACGTCGTCACTACCACCACCACCACCACCACGAC
GGTCATCGTCATCATCATCATCAACATCGTCGTCGTCGTCGTCGTCAACAACAACAACAACAACAACAACAAAAA
AAAAACCCGCCCTTCTCCTCCCTCGAAGACGAAGAGGACAAAGACGTGACCGTCGTCGTCCGCGAGGAGCACCTG
GCCGAATCCGAGCTCGAATCCGCCTCTTCCGACCCCGACTCGGCTTCCTCGTCCCATGACCAGACCGACAGCAAC
CAGCAGTCTTGTTATTCTCGTTCTTGTTCTTGTCCGGCCGCCACCACCGCTCCCCAAGACGACGACGACGGCGGT
GGCGGCGGTGGCGCCCTAGGCCGCCTCGTCGTCCTCCTCGACCGTCACAAGTCCCGGCTCGGCGTCCAGCACTAT
AGCGTCAGCCCTACCACGCTCGATCAGGTCTTTCTCGCCATCGTCGGCGCCGACAACGGCCGAGAGTTGGAGAGG
CCCCGGCCTGCTTTTTGGTCTTTGGTGCGGGAGTGGGCGCGGGCCGCTTGA
Gene >Ophio5|2500
ATGATTGCCAAGCGGCCGGCTAGGTTTCTCGTGCTCCGCCAGATATGGACGCTCACGTCAAAGGACCTTCGATGC
CTTCTCCGACGACATGGACTGCTCATGGCCAGCGTGGCCTTTGTGATGCCCTTGCTCCTGGCGGGCTTCTTTACC
TTTGCCAAGAACCTATTCCTGCCACCGGCAAAGTATGGCGTCGGCATCTCGCGGCCCATTTTAACGCTGCGAGAA
GCGGTCGAGATAGCGCACGGCAACGGACATGATAAGCTGATCCTAGTGGACGGGCCGGCCGGTTCAGGCGGCGAG
CAAAACATGTCGAGGCTACTCGACATCATCACCGAGGAGACGCAGTCGTACAGGTCGCCGATACGAACGGTGCGC
ATCTCCACTGAGTCCGACCTGGCATCGCACTGCCGCAGCACGCTGAGGGGCGTGACGCGCTGTTTGGGCGCCGTC
GTGATGCGAGGAGCGCCGCCAGCAGGGCCTTGGAACTACACGATTCGAACTGACGCCTTGGTGGCTTCCGGCTCG
CAGTTGATCAAGGTCCAGGAAGGGAGAAACGTCGAGCAGGTGTTTGTGCTGCCTCTGCAACGGGCTGTTGACTCT
GCCATTGCGACCATAGAAGCCGGCAGCGATGCCGACAACAACAACAACAACAACAACAACAACAACAATCCCCTG
GGCGTGGCCAACGAGTGGCCTTTTACCAGTCGTACGCAGGCCGAGTATGACGACAAGACGCGGAAGCAGTATCTC
GACGCCATCGTCAACTTCATGGGCGTCGCCTTCGTCACTACCATCATCAGCGTCACCTATCAACTCGCCGGCGCC
GTGGCCACGGACCGTGAGTCCGGCATAGCACGCCTCATCGACGCCATGTTGCCCGGATGCCGACCCGGCGCTGCT
CAGGTGACGCGTATCGCGGCTCATCACCTGGCTTACACGATTCTGTACGCGCCGGCGTGGATCGTGGCCGCCCTC
ATCGTCCGCTTCGGCATCTTCGTCTACACGTCGCTCGCCGTCGTCATCCTCTTGCAACTGCTGGGCGGTCTGGCC
TTTGTCTCCTTTTCCATCCTGTGCGCCAGCTTCTTTAACCGGGCCCAGCTAAGCAGTGCCAGTGCCACGCTCGCC
GCCTTTTTGCTGGCTATACTCGCCCAGTCGTTGACGTCGCCGGCAACCGTGACCGTCGCGGTGCTGTCTGCCCTG
TTCGCGCCCTGCAACTACGTCTACTTCATCACGCTTATGGCTCGCTTCGAGCGCCTGAATCGCCCGACAAGTCTC
ATCGATATGCCTCCCGGCGAGAGCCCCTGGGCGGTGCCGGGCTTGGCTTTGTGGTTGCTTCTTTGCCTGCAAATC
GTAGCTTACCCCCTGCTGGCGGCCTGGGTCGAGCGTTGGCGCTTCGGAACCCCGGCCGACGGGAGACGTTATGCC
CGAGCCGGTCAGCCGAATCCGAGCTTGGACGGTGATGTCGCCGTCCGGCTCGATGGCCTGACCAAGGTCTATTAC
CCGGCCCTGCTTCCGCGCCTCGCCGCCTTCTTCCGCTGCTGCGGCGCCGGAAGCCAGTCGACCGAGCCAGTCGTG
GCCGTCAACGGGCTCAATCTCAGCTGTCCGCGAGGCCAGATCGTCACTCTTCTCGGGGCCAACGGCAGCGGCAAG
AGCACAACACTCAATGCCATCGCCGGCCTTCATCAGCCGACGAGCGGCTCCATCTCGGTCGACGGCACGGGCGGA
CTCGGTATCGCGCCGCAGAAGAACGTGATGTGGGACGACGTGACGGTACAGGACCATCTGGACATCTTTGGACGG
CTCAAGTCGCCGGCGAGGCCGCCAACGACGGAGGAGACGGAAGAGCTCGTCCGGTCCATCGACCTATGGACGAAG
CGGAGGGCACTGGCCAAGACGCTCTCTGGAGGACAGAAGCGCAAGCTACAACTGGGCATGATGCTGGCGGGCGGC
AGCGCCGTGTGCTGCGTCGACGAGGTCAGCAGCGGCCTGGATCCCATCTCTCGACGCAAGATCTGGGACATTTTG
CTGGCCGAACGCGGCCGACGTACGTTGATCCTGACGACACACTTTCTCGACGAGGCCGATCTCCTGGCGGACCAC
ATGGCCATCCTCTCACGCGGCACCCTCCGGGCCGCCGGCTCCTCGGTCGAGCTCAAGGAACGCTTCGGAGGCGGC
TACCGCGTCCGCGTCCCGGCCGGAGCCGGGCCTGAAGTCCAGGGCGTGGAGCGCAAGGAGGCGGCCGACGGGACG
ACGTACGCGGCGCCTACTTCGGACCTGGCGGCGAGGGTGATACGGCGGCTCGACTCCGGCGGCGTGGCCGATTAT
CACTTTTCCAGCCCGACTATCGAGGACGTCTTCTTGCGGCTGGTTGAGGAGGTCGAGGTTGATCGAGTCTCACAC
CCGCCGCCATCAACCGAAACCAAGACGGCCGGCGACGACAAGTTATCCCGGGAAGACCGGCCGCCGCTCAAGCTC
ATGGACGGCTCCGTCGTCGGAAACGGACGGCAGATGCTCGTGCTGTTGCGGAAGAGGGCGACCGTCTTTAAGCGC
AACTGGGTTCTCTACATGGTGGCCTTTCTACTGCCCGTCCTGGCGGCGGTGCTGACATCCATGTACGTCCGCGGA
AAGGATCCCACCGGGTGCAGCTCGCCGCGATATAAGACAGTCGAGGACGCCATGAGCCGGATGACGAAAGAGAAT
TACAAGCCCAGGCTGGTCATGGGACCGTCGTCGAGTCTGGATCGGACGGAACTACTCCGCGTGCTGACGCCCCTA
TTCAATGACACCCGCCATAGGCTCCGACACGGCCCCGACGACAGCGGCGGGCTGCAGATGGATACGGAGCAGGTC
AGATGGGCCAAGACGTACGACGAATTCAGCGGCTTCGTGACGGGCGGATGGAGGAACCTTACAGCCGGCGTCTGG
CTGGGCGACGAGTCCTCACCGCCGACCATGGCCTGGCTGGCCAACAAGGCCATCTTGGTGCCTCTGATAGCGCAG
CAGCTTCTCGACTCGCTTCAGGCCCGAAAGACGATCCTGACGTCGTGGCTGCCCTTTGACGTGCCCTTCGACCCG
GCCGTCGGCTCCGTTCTCAACCTGGTCGTCTACATGGCACTGGCCCTCATCTTCTTCCCGGCCTTCTTCGGCCTC
TATCCCAGCAGCGAGCGCACGAGCGGCGTACGGGCACTGCAGTACTCCAACGGCGTGAGACCTCTCCCGCTGTGG
GCTGCGTACGCGGCCTTTGATATGATGTTTGTCCTGGCTACTGCCGCGCTGGTGACGGCTCTCTGGGCCGTCTTG
GCCCACTCCTGGTATCACCTCGGCTTCATATTCGTCGTTCTGGCGCTATACGGACTGGCTTCGACGGAATTCGCC
TATCTGGTCTCGCTGTCTGCTCGGTCGCAGCTGGCGAGCTTCGCGTGGACCGTCGTATTGCAGTGCATTGTCTTC
CTCGTCTACCTCATCACCTACGTGTGCGTCTTGACGTACGTCAGTGTCGATCGGGTGGACGGAGCCCTTTTCATC
TCTCACCTCGTGCTATCGGCCCTTGCACCCATCGGCTCCGTCGTTCGCTCGCTCTTCATCGCCACCAACTTATTC
TCGACGGCCTGCGACGGGAGGAAGCTGTCGAGCCGGCCGGCCGGCTTGGCCCTGTACGGCGGTCCGATCCTCTAT
CTTTCGGTGCAGTGCGTCTTGCTGTTCGGCCTGCTCGTCTGGTTCGATGGCGGTTCGGCAATGCGCCGGGGCCGC
GGTTCGAAGCTGGACAGTCGAGAGGACGGTTATGGCGCCGAAGGCAACAAGGCCGGAGTGGGCCACCTCGACGGA
ACCGGAGCCGGAGACGAGGGGCTCCGGGTCGCGAATCTGACCAAATCGTTCGGACGCAACACGGCCGTCGACAAC
GTCTCGTTCGGCGTTGGTCGCGGCGAGGTCTTTGCGCTGCTGGGTCCCAACGGAGCCGGTAAATCGACAACCATG
GCCCTGATCCGCGGAGACGAGCGTCCGAGCCGGAACGGGGGCGACGTCTTCGTCGGCCCGGCCTCGGTCACGCGC
AACCGAGCCGCAGCGCGAGCCCTTCTCGGCGTATGCCCACAGATGGACGCTCTGGATTCCTTCATGACGGTACGA
GAACATCTCGACTTCTACGCCCGCGTCCGAGGCGTGCCAGACGCGGACCACAACGTCCAAGCCGTCCTGGTCGCC
GTCGGCCTCGAAGGCCTATCGTCGCGAATGGCGACGGCGCTCTCGGGCGGAAACAAGCGGAAGCTCAGCCTGGCC
ATGGCGCTGATGGGGAACCCCGCCGTCGTCCTCCTGGACGAGCCGTCTTCCGGTCTCGACGCGGCGGCCAAGCGG
ATCCTGTGGCCGGTTTTGGCCTCGGCCGCCGCCGGGCGCTCTATCCTTCTCACGACGCATAGCATGGAGGAGGCT
GACGCTCTGGCAGCCCGGGCCGGCATCCTCGCTCGTCGGATGCTCGCGTTGGGGTCGTTGGACGAGTTGCGTCGG
AGGGCTGGTCATCGTCTTCATGTTCATCTCGTCGCTGCTTCGGCGCCTCGGACGACGCCGGCGCAGATGGCGAGG
ATGGCCGACTGGGTTCGTGTCGCTATGCCCGAGGCTGAGCTCGAGCCGGAGACGTATCACGGTCAGATGCGGTTT
GCTGTTCGCGCCAAGGACGTGGCCGCTGCCGGAACCAATCTACGTCGTCACTACCACCACCACCACCACCACGAC
GGTCATCGTCATCATCATCATCAACATCGTCGTCGTCGTCGTCGTCAACAACAACAACAACAACAACAACAAAAA
AAAAACCCGCCCTTCTCCTCCCTCGAAGACGAAGAGGACAAAGACGTGACCGTCGTCGTCCGCGAGGAGCACCTG
GCCGAATCCGAGCTCGAATCCGCCTCTTCCGACCCCGACTCGGCTTCCTCGTCCCATGACCAGACCGACAGCAAC
CAGCAGTCTTGTTATTCTCGTTCTTGTTCTTGTCCGGCCGCCACCACCGCTCCCCAAGACGACGACGACGGCGGT
GGCGGCGGTGGCGCCCTAGGCCGCCTCGTCGTCCTCCTCGACCGTCACAAGTCCCGGCTCGGCGTCCAGCACTAT
AGCGTCAGCCCTACCACGCTCGATCAGGTCTTTCTCGCCATCGTCGGCGCCGACAACGGCCGAGAGTTGGAGAGG
CCCCGGCCTGCTTTTTGGTCTTTGGTGCGGGAGTGGGCGCGGGCCGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail