Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2498
Gene name
Locationscaffold_206:22646..25113
Strand+
Gene length (bp)2467
Transcript length (bp)2409
Coding sequence length (bp)2406
Protein length (aa) 802

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03835 Rad4 Rad4 transglutaminase-like domain 1.4E-28 398 513
PF10405 BHD_3 Rad4 beta-hairpin domain 3 1.7E-25 647 719
PF10403 BHD_1 Rad4 beta-hairpin domain 1 1.9E-22 519 574
PF10404 BHD_2 Rad4 beta-hairpin domain 2 7.1E-20 578 640

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 83 758 3.0E-96
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 404 800 1.0E-51
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 404 757 2.0E-50
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 408 757 2.0E-45
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 408 757 3.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 83 758 3.0E-96
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 404 800 1.0E-51
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 404 757 2.0E-50
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 408 757 2.0E-45
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 408 757 3.0E-42
sp|Q24595|XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster GN=Xpc PE=1 SV=2 408 757 5.0E-40
sp|Q8W489|RAD4_ARATH DNA repair protein RAD4 OS=Arabidopsis thaliana GN=RAD4 PE=1 SV=1 405 777 1.0E-30
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 89 316 5.0E-13
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 144 323 4.0E-11
sp|Q06665|RAD34_YEAST DNA repair protein RAD34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD34 PE=1 SV=1 522 757 1.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4056 0.9104 0.0524 0.0117 0.1462 0.0075 0.0406 0.0317 0.0426 0.0056

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3812
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3345
Ophiocordyceps australis map64 (Brazil) OphauB2|7020
Ophiocordyceps camponoti-floridani Ophcf2|01135
Ophiocordyceps camponoti-rufipedis Ophun1|3928
Ophiocordyceps kimflemingae Ophio5|2498 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7460

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2498
MVGRKRAATARGGRGGGVSASHGEPDVYRQMLDEAGVTSRDAAETERPLKRRRPVSRQQNKSISPEIDKGRLPSN
VAGAQNDDDDDDDDDDDEGVEFQDVIIPEPTVQTMEWESDDDEGEEETEFAKMRQEPQTPEATELELNLTVPTTP
SKGPGERRRPITKEEKARRIDIHRTHLLCLLSHVARRNYWCNDAKVQETLRPLLSDKTIHYLTPGAHLPQFGQAE
SLKKGLQQAADVWKTKFEIRERGLRRALWAEDPEQLEGFEPPGDMDSCLDRAEFREAARKLQGSRDVGAQLYCAL
LRSVGVRARLVCSLQPLACITGAPVMAKPREKLRTPSKDSSREALAKYEAMAGKTSPASPSGATARRRLGHPSAA
AYDFKPAARPPPSSGRAFEAPVKIRESPHPVYWVEVLDTGHQKWQPADPMVTDSFWKPKVMEPPVTDKENCLCYV
VAWEADGTAKDVTRRYAKAYTAKTRKLRVESALEDGDKWWSRALKLYRRRRPTDLDQIEDGELLGIEAREPMPRN
VQDFKDHPVYALERHMRRNEVLVPEAKPSGTVGAGSRGPLEKIYRRRDVRIARSADKWYRLGRLVKPNEIPAKWL
PKKARPRRPRASDADAEAADKGDAGTPIYRMEQTELYEPPAVCDGRVPKNRFGNIEVYVPSMVPRGAIHLIGEHA
ARSALIAGIDYAPALTGFQFQGRHGTAVLHGIVVAAEFEEALRALMEGLTQAEQERISEVRRLALLAAWRRLLMG
LRIRERIWSGVDEEERREAERRAEVEAGVCSSETTEELDMEMDDEGGGFLVE
Coding >Ophio5|2498
ATGGTTGGAAGAAAGCGCGCCGCAACTGCAAGAGGCGGAAGAGGAGGAGGCGTCTCCGCCAGTCACGGGGAACCG
GACGTCTACCGTCAGATGCTCGACGAAGCCGGAGTGACATCCCGGGACGCCGCCGAGACGGAGAGGCCACTGAAG
CGGAGGCGGCCAGTCTCTCGTCAACAGAACAAGTCCATTTCGCCCGAAATCGACAAAGGTCGGTTGCCCTCGAAC
GTTGCAGGGGCCCAAAATGACGACGACGACGACGACGACGACGACGACGACGAGGGGGTCGAGTTCCAAGACGTT
ATCATACCGGAGCCTACGGTCCAGACCATGGAGTGGGAATCAGACGATGACGAGGGTGAAGAAGAAACTGAATTC
GCCAAAATGCGGCAAGAACCCCAGACGCCAGAAGCTACCGAACTCGAGCTCAACCTCACTGTTCCCACGACACCG
AGCAAGGGGCCGGGAGAGCGACGCAGACCAATAACCAAGGAGGAAAAGGCGCGCCGTATAGACATACACCGAACA
CACCTCCTGTGCTTGCTGTCGCATGTCGCGCGACGGAACTACTGGTGCAACGACGCCAAAGTGCAAGAGACTCTA
CGCCCGCTCCTCTCGGACAAGACCATACACTACCTCACTCCCGGAGCCCATCTCCCGCAGTTTGGACAGGCCGAG
AGCCTAAAGAAGGGGCTGCAACAAGCGGCAGATGTGTGGAAGACCAAATTTGAGATTCGAGAACGTGGCTTGAGG
AGGGCGCTGTGGGCCGAGGATCCCGAACAACTCGAGGGTTTTGAACCGCCTGGCGATATGGATTCCTGTCTGGAC
CGTGCCGAGTTTCGCGAAGCGGCCAGGAAGCTTCAAGGATCCCGTGACGTAGGCGCGCAACTCTATTGCGCTCTT
CTTCGCAGCGTGGGGGTTCGCGCGAGACTCGTTTGCTCGCTACAGCCTCTTGCCTGCATCACCGGGGCGCCCGTC
ATGGCCAAGCCCAGGGAAAAGCTACGCACGCCCAGCAAAGATAGCTCCAGAGAAGCATTGGCCAAATATGAGGCA
ATGGCCGGCAAGACATCCCCAGCATCTCCGAGCGGAGCGACGGCGAGACGCAGGTTGGGCCATCCGAGCGCGGCA
GCCTACGATTTCAAGCCCGCTGCGCGGCCACCGCCGTCATCTGGGCGAGCATTCGAGGCGCCGGTCAAGATACGC
GAGTCACCGCATCCCGTCTACTGGGTCGAGGTGCTGGATACGGGCCACCAAAAGTGGCAGCCGGCGGACCCCATG
GTCACGGACAGCTTCTGGAAGCCCAAAGTGATGGAGCCCCCCGTCACGGACAAGGAGAATTGTCTCTGCTACGTG
GTGGCATGGGAAGCCGACGGGACGGCCAAAGACGTGACGAGAAGGTACGCCAAGGCCTACACGGCCAAGACGCGT
AAGCTGCGCGTGGAGAGCGCACTGGAGGACGGTGATAAGTGGTGGAGTCGAGCCTTGAAGCTCTATCGGCGACGG
CGGCCGACGGACCTGGACCAGATCGAGGACGGAGAGCTCCTCGGGATCGAGGCCCGCGAACCGATGCCACGGAAT
GTGCAGGACTTTAAAGATCACCCGGTCTACGCGCTCGAACGACACATGCGGCGAAACGAGGTGCTGGTTCCCGAA
GCGAAGCCGTCCGGCACCGTCGGCGCCGGCAGCCGGGGACCGCTGGAGAAGATTTACCGGCGCCGTGACGTCCGT
ATCGCCCGAAGTGCTGACAAGTGGTATCGTCTGGGACGGCTGGTAAAGCCCAACGAGATACCGGCCAAGTGGCTG
CCCAAGAAGGCTCGGCCAAGACGCCCACGAGCGAGCGACGCGGACGCAGAAGCGGCGGACAAGGGCGATGCTGGA
ACGCCCATCTACAGGATGGAGCAGACGGAATTGTACGAGCCGCCGGCGGTATGCGACGGACGGGTGCCAAAGAAT
AGGTTTGGCAATATCGAGGTGTACGTGCCGAGCATGGTACCGAGAGGGGCAATACACCTGATCGGGGAGCATGCA
GCGCGGTCAGCCCTGATAGCCGGCATCGACTACGCACCGGCGCTGACGGGATTCCAATTCCAGGGACGCCACGGC
ACCGCGGTTCTGCATGGAATCGTGGTGGCGGCGGAGTTTGAGGAGGCGCTGCGGGCGCTGATGGAGGGTCTGACT
CAGGCGGAACAGGAGAGGATCTCGGAAGTGCGGCGACTCGCTTTGCTGGCGGCGTGGCGCAGGCTGTTGATGGGG
CTGCGGATCCGCGAGAGGATCTGGAGTGGCGTGGACGAAGAGGAGAGACGGGAGGCGGAGAGGCGGGCCGAAGTG
GAAGCGGGCGTGTGCTCGAGCGAGACAACTGAGGAGTTGGACATGGAGATGGACGACGAGGGAGGAGGTTTCTTG
GTCGAG
Transcript >Ophio5|2498
ATGGTTGGAAGAAAGCGCGCCGCAACTGCAAGAGGCGGAAGAGGAGGAGGCGTCTCCGCCAGTCACGGGGAACCG
GACGTCTACCGTCAGATGCTCGACGAAGCCGGAGTGACATCCCGGGACGCCGCCGAGACGGAGAGGCCACTGAAG
CGGAGGCGGCCAGTCTCTCGTCAACAGAACAAGTCCATTTCGCCCGAAATCGACAAAGGTCGGTTGCCCTCGAAC
GTTGCAGGGGCCCAAAATGACGACGACGACGACGACGACGACGACGACGACGAGGGGGTCGAGTTCCAAGACGTT
ATCATACCGGAGCCTACGGTCCAGACCATGGAGTGGGAATCAGACGATGACGAGGGTGAAGAAGAAACTGAATTC
GCCAAAATGCGGCAAGAACCCCAGACGCCAGAAGCTACCGAACTCGAGCTCAACCTCACTGTTCCCACGACACCG
AGCAAGGGGCCGGGAGAGCGACGCAGACCAATAACCAAGGAGGAAAAGGCGCGCCGTATAGACATACACCGAACA
CACCTCCTGTGCTTGCTGTCGCATGTCGCGCGACGGAACTACTGGTGCAACGACGCCAAAGTGCAAGAGACTCTA
CGCCCGCTCCTCTCGGACAAGACCATACACTACCTCACTCCCGGAGCCCATCTCCCGCAGTTTGGACAGGCCGAG
AGCCTAAAGAAGGGGCTGCAACAAGCGGCAGATGTGTGGAAGACCAAATTTGAGATTCGAGAACGTGGCTTGAGG
AGGGCGCTGTGGGCCGAGGATCCCGAACAACTCGAGGGTTTTGAACCGCCTGGCGATATGGATTCCTGTCTGGAC
CGTGCCGAGTTTCGCGAAGCGGCCAGGAAGCTTCAAGGATCCCGTGACGTAGGCGCGCAACTCTATTGCGCTCTT
CTTCGCAGCGTGGGGGTTCGCGCGAGACTCGTTTGCTCGCTACAGCCTCTTGCCTGCATCACCGGGGCGCCCGTC
ATGGCCAAGCCCAGGGAAAAGCTACGCACGCCCAGCAAAGATAGCTCCAGAGAAGCATTGGCCAAATATGAGGCA
ATGGCCGGCAAGACATCCCCAGCATCTCCGAGCGGAGCGACGGCGAGACGCAGGTTGGGCCATCCGAGCGCGGCA
GCCTACGATTTCAAGCCCGCTGCGCGGCCACCGCCGTCATCTGGGCGAGCATTCGAGGCGCCGGTCAAGATACGC
GAGTCACCGCATCCCGTCTACTGGGTCGAGGTGCTGGATACGGGCCACCAAAAGTGGCAGCCGGCGGACCCCATG
GTCACGGACAGCTTCTGGAAGCCCAAAGTGATGGAGCCCCCCGTCACGGACAAGGAGAATTGTCTCTGCTACGTG
GTGGCATGGGAAGCCGACGGGACGGCCAAAGACGTGACGAGAAGGTACGCCAAGGCCTACACGGCCAAGACGCGT
AAGCTGCGCGTGGAGAGCGCACTGGAGGACGGTGATAAGTGGTGGAGTCGAGCCTTGAAGCTCTATCGGCGACGG
CGGCCGACGGACCTGGACCAGATCGAGGACGGAGAGCTCCTCGGGATCGAGGCCCGCGAACCGATGCCACGGAAT
GTGCAGGACTTTAAAGATCACCCGGTCTACGCGCTCGAACGACACATGCGGCGAAACGAGGTGCTGGTTCCCGAA
GCGAAGCCGTCCGGCACCGTCGGCGCCGGCAGCCGGGGACCGCTGGAGAAGATTTACCGGCGCCGTGACGTCCGT
ATCGCCCGAAGTGCTGACAAGTGGTATCGTCTGGGACGGCTGGTAAAGCCCAACGAGATACCGGCCAAGTGGCTG
CCCAAGAAGGCTCGGCCAAGACGCCCACGAGCGAGCGACGCGGACGCAGAAGCGGCGGACAAGGGCGATGCTGGA
ACGCCCATCTACAGGATGGAGCAGACGGAATTGTACGAGCCGCCGGCGGTATGCGACGGACGGGTGCCAAAGAAT
AGGTTTGGCAATATCGAGGTGTACGTGCCGAGCATGGTACCGAGAGGGGCAATACACCTGATCGGGGAGCATGCA
GCGCGGTCAGCCCTGATAGCCGGCATCGACTACGCACCGGCGCTGACGGGATTCCAATTCCAGGGACGCCACGGC
ACCGCGGTTCTGCATGGAATCGTGGTGGCGGCGGAGTTTGAGGAGGCGCTGCGGGCGCTGATGGAGGGTCTGACT
CAGGCGGAACAGGAGAGGATCTCGGAAGTGCGGCGACTCGCTTTGCTGGCGGCGTGGCGCAGGCTGTTGATGGGG
CTGCGGATCCGCGAGAGGATCTGGAGTGGCGTGGACGAAGAGGAGAGACGGGAGGCGGAGAGGCGGGCCGAAGTG
GAAGCGGGCGTGTGCTCGAGCGAGACAACTGAGGAGTTGGACATGGAGATGGACGACGAGGGAGGAGGTTTCTTG
GTCGAGTAA
Gene >Ophio5|2498
ATGGTTGGAAGAAAGCGCGCCGCAACTGCAAGAGGCGGAAGAGGAGGAGGCGTCTCCGCCAGTCACGGGGAACCG
GACGTCTACCGTCAGATGCTCGACGAAGCCGGAGTGACATCCCGGGACGCCGCCGAGACGGAGAGGCCACTGAAG
CGGAGGCGGCCAGTCTCTCGTCAACAGAACAAGTCCATTTCGCCCGAAATCGACAAAGGTCGGTTGCCCTCGAAC
GTTGCAGGGGCCCAAAATGACGACGACGACGACGACGACGACGACGACGACGAGGGGGTCGAGTTCCAAGACGTT
ATCATACCGGAGCCTACGGTCCAGACCATGGAGTGGGAATCAGACGATGACGAGGGTGAAGAAGAAACTGAATTC
GCCAAAATGCGGCAAGAACCCCAGACGCCAGAAGCTACCGAACTCGAGCTCAACCTCACTGTTCCCACGACACCG
AGCAAGGGGCCGGGAGAGCGACGCAGACCAATAACCAAGGAGGAAAAGGCGCGCCGTATAGACATACACCGAACA
CACCTCCTGTGCTTGCTGTCGCATGTCGCGCGACGGAACTACTGGTGCAACGACGCCAAAGTGCAAGAGACTCTA
CGCCCGCTCCTCTCGGACAAGACCATACACTACCTCACTCCCGGAGCCCATCTCCCGCAGTTTGGACAGGCCGAG
AGCCTAAAGAAGGGGCTGCAACAAGCGGCAGATGTGTGGAAGACCAAATTTGAGATTCGAGAACGTGGCTTGAGG
AGGGCGCTGTGGGCCGAGGATCCCGAACAACTCGAGGGTGTGAGCGTCTCCGCCATCTCTATATTCTCTTCAGGA
GGCGCGCTGACGCCTCTGACAGTTTGAACCGCCTGGCGATATGGATTCCTGTCTGGACCGTGCCGAGTTTCGCGA
AGCGGCCAGGAAGCTTCAAGGATCCCGTGACGTAGGCGCGCAACTCTATTGCGCTCTTCTTCGCAGCGTGGGGGT
TCGCGCGAGACTCGTTTGCTCGCTACAGCCTCTTGCCTGCATCACCGGGGCGCCCGTCATGGCCAAGCCCAGGGA
AAAGCTACGCACGCCCAGCAAAGATAGCTCCAGAGAAGCATTGGCCAAATATGAGGCAATGGCCGGCAAGACATC
CCCAGCATCTCCGAGCGGAGCGACGGCGAGACGCAGGTTGGGCCATCCGAGCGCGGCAGCCTACGATTTCAAGCC
CGCTGCGCGGCCACCGCCGTCATCTGGGCGAGCATTCGAGGCGCCGGTCAAGATACGCGAGTCACCGCATCCCGT
CTACTGGGTCGAGGTGCTGGATACGGGCCACCAAAAGTGGCAGCCGGCGGACCCCATGGTCACGGACAGCTTCTG
GAAGCCCAAAGTGATGGAGCCCCCCGTCACGGACAAGGAGAATTGTCTCTGCTACGTGGTGGCATGGGAAGCCGA
CGGGACGGCCAAAGACGTGACGAGAAGGTACGCCAAGGCCTACACGGCCAAGACGCGTAAGCTGCGCGTGGAGAG
CGCACTGGAGGACGGTGATAAGTGGTGGAGTCGAGCCTTGAAGCTCTATCGGCGACGGCGGCCGACGGACCTGGA
CCAGATCGAGGACGGAGAGCTCCTCGGGATCGAGGCCCGCGAACCGATGCCACGGAATGTGCAGGACTTTAAAGA
TCACCCGGTCTACGCGCTCGAACGACACATGCGGCGAAACGAGGTGCTGGTTCCCGAAGCGAAGCCGTCCGGCAC
CGTCGGCGCCGGCAGCCGGGGACCGCTGGAGAAGATTTACCGGCGCCGTGACGTCCGTATCGCCCGAAGTGCTGA
CAAGTGGTATCGTCTGGGACGGCTGGTAAAGCCCAACGAGATACCGGCCAAGTGGCTGCCCAAGAAGGCTCGGCC
AAGACGCCCACGAGCGAGCGACGCGGACGCAGAAGCGGCGGACAAGGGCGATGCTGGAACGCCCATCTACAGGAT
GGAGCAGACGGAATTGTACGAGCCGCCGGCGGTATGCGACGGACGGGTGCCAAAGAATAGGTTTGGCAATATCGA
GGTGTACGTGCCGAGCATGGTACCGAGAGGGGCAATACACCTGATCGGGGAGCATGCAGCGCGGTCAGCCCTGAT
AGCCGGCATCGACTACGCACCGGCGCTGACGGGATTCCAATTCCAGGGACGCCACGGCACCGCGGTTCTGCATGG
AATCGTGGTGGCGGCGGAGTTTGAGGAGGCGCTGCGGGCGCTGATGGAGGGTCTGACTCAGGCGGAACAGGAGAG
GATCTCGGAAGTGCGGCGACTCGCTTTGCTGGCGGCGTGGCGCAGGCTGTTGATGGGGCTGCGGATCCGCGAGAG
GATCTGGAGTGGCGTGGACGAAGAGGAGAGACGGGAGGCGGAGAGGCGGGCCGAAGTGGAAGCGGGCGTGTGCTC
GAGCGAGACAACTGAGGAGTTGGACATGGAGATGGACGACGAGGGAGGAGGTTTCTTGGTCGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail