Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2494
Gene name
Locationscaffold_206:12000..13533
Strand+
Gene length (bp)1533
Transcript length (bp)1533
Coding sequence length (bp)1530
Protein length (aa) 510

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2571 0.7827 0.1683 0.0219 0.0807 0.0108 0.0763 0.0107 0.0065 0.0013

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1307
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3340
Ophiocordyceps australis map64 (Brazil) OphauB2|7015
Ophiocordyceps camponoti-floridani Ophcf2|01131
Ophiocordyceps camponoti-rufipedis Ophun1|3932
Ophiocordyceps kimflemingae Ophio5|2494 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1063

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2494
MPTEAAPCSPSAAIDYVRLHITPLDADVVNVILPASVRPRSRNLSFHTIQTFPENRYGFVDLPRMDAGNLKRKLN
GSLLKGTKIRVEDARPEERTEPTGDAARPEKKRKILTKDKPKKIDPQILEGVTLKDRKVKRGWTEKPGVKGKGAK
DKDAARKRQRSRYTDKEECLLKVKVPPCAMGNLPADAVSKKKKEKGKSRHVVVHEFEKTTNFPSFLKFSAPDKDG
KAATEFVEGKGWVDDDGTLVETVRGRQSCLSKKPSVSMSDEKEDSSSRATSPDSTSSSGTSSEDETEDDEESSAE
ESTSRVHEERPASAVKEAGKNAIATDGGSSPSPSSPKSLTIKIPRLESQPTIHPLEALYKRPQPGPDATKCPPQP
EPFSFFGGASGDEDDAPVEKSANQSGSKMPMTPFTRQDFEQRGVRSAAPTPDTAHPSRKHLFWGSQEEDDEDKDE
DEDEEADPDHASQPQPGQSDFQTWFWENRRELNRSWMTRRKTAAKEKRHRENKARTSRAA
Coding >Ophio5|2494
ATGCCCACGGAAGCTGCGCCTTGCTCCCCATCTGCGGCAATCGACTACGTCCGCTTGCACATCACGCCTCTGGAC
GCAGACGTCGTCAACGTCATCCTCCCCGCCTCGGTGCGGCCGCGATCGCGTAACCTCTCGTTCCACACGATCCAG
ACATTTCCCGAGAACCGATACGGCTTCGTCGACCTGCCCAGAATGGATGCCGGCAATTTAAAGAGAAAGCTCAAC
GGCTCGCTGCTCAAGGGTACCAAGATCCGCGTTGAAGACGCCCGGCCGGAGGAACGCACTGAGCCGACGGGCGAC
GCGGCCCGACCCGAGAAGAAGCGCAAGATACTCACCAAAGACAAGCCTAAGAAAATAGATCCTCAAATCTTGGAG
GGCGTAACACTCAAGGATCGAAAGGTCAAGCGTGGTTGGACCGAGAAGCCCGGTGTCAAGGGTAAGGGCGCAAAA
GACAAGGACGCCGCCCGAAAGCGACAAAGGTCACGATATACGGACAAGGAGGAGTGCCTGCTCAAGGTCAAGGTT
CCACCCTGCGCCATGGGCAATCTGCCGGCCGACGCTGTGAGCAAGAAAAAAAAGGAGAAGGGAAAGTCGCGGCAT
GTCGTGGTCCACGAGTTCGAGAAGACAACCAACTTTCCTAGCTTTCTCAAGTTCTCTGCTCCCGACAAGGATGGT
AAGGCGGCGACGGAATTTGTCGAGGGCAAAGGCTGGGTCGATGACGATGGCACGCTAGTCGAAACGGTCAGAGGC
AGGCAATCATGCCTGTCAAAGAAGCCGAGCGTCTCCATGTCCGATGAAAAAGAAGATTCAAGCAGCCGCGCCACG
TCTCCTGACAGCACGAGTAGCAGTGGCACTTCCTCCGAAGATGAGACCGAGGACGATGAGGAGTCTTCTGCCGAA
GAGTCGACCAGCCGTGTGCATGAGGAGAGGCCTGCCTCGGCCGTGAAGGAAGCAGGGAAGAATGCAATTGCGACG
GATGGCGGCAGCTCGCCATCGCCAAGCTCACCGAAAAGCCTCACCATCAAGATCCCCCGACTCGAATCGCAGCCG
ACCATCCACCCGCTAGAAGCGCTATACAAGCGACCGCAGCCGGGCCCTGACGCGACCAAGTGCCCCCCACAGCCC
GAGCCTTTCAGCTTTTTCGGCGGAGCGTCCGGCGATGAAGACGATGCCCCAGTGGAAAAGTCGGCAAACCAGTCA
GGCTCGAAGATGCCCATGACGCCCTTCACTCGCCAGGACTTTGAGCAGCGCGGCGTCCGAAGCGCCGCGCCGACT
CCGGACACGGCGCACCCGTCGAGGAAGCACCTCTTCTGGGGCTCGCAGGAAGAGGATGACGAGGACAAGGACGAG
GACGAGGACGAAGAAGCCGATCCGGACCACGCTTCTCAACCGCAACCGGGTCAGAGCGACTTCCAGACCTGGTTT
TGGGAGAATAGGCGTGAGCTGAATCGCTCGTGGATGACGCGCCGGAAGACGGCGGCAAAGGAGAAGCGGCATCGG
GAGAATAAGGCGAGGACGTCGAGAGCCGCT
Transcript >Ophio5|2494
ATGCCCACGGAAGCTGCGCCTTGCTCCCCATCTGCGGCAATCGACTACGTCCGCTTGCACATCACGCCTCTGGAC
GCAGACGTCGTCAACGTCATCCTCCCCGCCTCGGTGCGGCCGCGATCGCGTAACCTCTCGTTCCACACGATCCAG
ACATTTCCCGAGAACCGATACGGCTTCGTCGACCTGCCCAGAATGGATGCCGGCAATTTAAAGAGAAAGCTCAAC
GGCTCGCTGCTCAAGGGTACCAAGATCCGCGTTGAAGACGCCCGGCCGGAGGAACGCACTGAGCCGACGGGCGAC
GCGGCCCGACCCGAGAAGAAGCGCAAGATACTCACCAAAGACAAGCCTAAGAAAATAGATCCTCAAATCTTGGAG
GGCGTAACACTCAAGGATCGAAAGGTCAAGCGTGGTTGGACCGAGAAGCCCGGTGTCAAGGGTAAGGGCGCAAAA
GACAAGGACGCCGCCCGAAAGCGACAAAGGTCACGATATACGGACAAGGAGGAGTGCCTGCTCAAGGTCAAGGTT
CCACCCTGCGCCATGGGCAATCTGCCGGCCGACGCTGTGAGCAAGAAAAAAAAGGAGAAGGGAAAGTCGCGGCAT
GTCGTGGTCCACGAGTTCGAGAAGACAACCAACTTTCCTAGCTTTCTCAAGTTCTCTGCTCCCGACAAGGATGGT
AAGGCGGCGACGGAATTTGTCGAGGGCAAAGGCTGGGTCGATGACGATGGCACGCTAGTCGAAACGGTCAGAGGC
AGGCAATCATGCCTGTCAAAGAAGCCGAGCGTCTCCATGTCCGATGAAAAAGAAGATTCAAGCAGCCGCGCCACG
TCTCCTGACAGCACGAGTAGCAGTGGCACTTCCTCCGAAGATGAGACCGAGGACGATGAGGAGTCTTCTGCCGAA
GAGTCGACCAGCCGTGTGCATGAGGAGAGGCCTGCCTCGGCCGTGAAGGAAGCAGGGAAGAATGCAATTGCGACG
GATGGCGGCAGCTCGCCATCGCCAAGCTCACCGAAAAGCCTCACCATCAAGATCCCCCGACTCGAATCGCAGCCG
ACCATCCACCCGCTAGAAGCGCTATACAAGCGACCGCAGCCGGGCCCTGACGCGACCAAGTGCCCCCCACAGCCC
GAGCCTTTCAGCTTTTTCGGCGGAGCGTCCGGCGATGAAGACGATGCCCCAGTGGAAAAGTCGGCAAACCAGTCA
GGCTCGAAGATGCCCATGACGCCCTTCACTCGCCAGGACTTTGAGCAGCGCGGCGTCCGAAGCGCCGCGCCGACT
CCGGACACGGCGCACCCGTCGAGGAAGCACCTCTTCTGGGGCTCGCAGGAAGAGGATGACGAGGACAAGGACGAG
GACGAGGACGAAGAAGCCGATCCGGACCACGCTTCTCAACCGCAACCGGGTCAGAGCGACTTCCAGACCTGGTTT
TGGGAGAATAGGCGTGAGCTGAATCGCTCGTGGATGACGCGCCGGAAGACGGCGGCAAAGGAGAAGCGGCATCGG
GAGAATAAGGCGAGGACGTCGAGAGCCGCTTAG
Gene >Ophio5|2494
ATGCCCACGGAAGCTGCGCCTTGCTCCCCATCTGCGGCAATCGACTACGTCCGCTTGCACATCACGCCTCTGGAC
GCAGACGTCGTCAACGTCATCCTCCCCGCCTCGGTGCGGCCGCGATCGCGTAACCTCTCGTTCCACACGATCCAG
ACATTTCCCGAGAACCGATACGGCTTCGTCGACCTGCCCAGAATGGATGCCGGCAATTTAAAGAGAAAGCTCAAC
GGCTCGCTGCTCAAGGGTACCAAGATCCGCGTTGAAGACGCCCGGCCGGAGGAACGCACTGAGCCGACGGGCGAC
GCGGCCCGACCCGAGAAGAAGCGCAAGATACTCACCAAAGACAAGCCTAAGAAAATAGATCCTCAAATCTTGGAG
GGCGTAACACTCAAGGATCGAAAGGTCAAGCGTGGTTGGACCGAGAAGCCCGGTGTCAAGGGTAAGGGCGCAAAA
GACAAGGACGCCGCCCGAAAGCGACAAAGGTCACGATATACGGACAAGGAGGAGTGCCTGCTCAAGGTCAAGGTT
CCACCCTGCGCCATGGGCAATCTGCCGGCCGACGCTGTGAGCAAGAAAAAAAAGGAGAAGGGAAAGTCGCGGCAT
GTCGTGGTCCACGAGTTCGAGAAGACAACCAACTTTCCTAGCTTTCTCAAGTTCTCTGCTCCCGACAAGGATGGT
AAGGCGGCGACGGAATTTGTCGAGGGCAAAGGCTGGGTCGATGACGATGGCACGCTAGTCGAAACGGTCAGAGGC
AGGCAATCATGCCTGTCAAAGAAGCCGAGCGTCTCCATGTCCGATGAAAAAGAAGATTCAAGCAGCCGCGCCACG
TCTCCTGACAGCACGAGTAGCAGTGGCACTTCCTCCGAAGATGAGACCGAGGACGATGAGGAGTCTTCTGCCGAA
GAGTCGACCAGCCGTGTGCATGAGGAGAGGCCTGCCTCGGCCGTGAAGGAAGCAGGGAAGAATGCAATTGCGACG
GATGGCGGCAGCTCGCCATCGCCAAGCTCACCGAAAAGCCTCACCATCAAGATCCCCCGACTCGAATCGCAGCCG
ACCATCCACCCGCTAGAAGCGCTATACAAGCGACCGCAGCCGGGCCCTGACGCGACCAAGTGCCCCCCACAGCCC
GAGCCTTTCAGCTTTTTCGGCGGAGCGTCCGGCGATGAAGACGATGCCCCAGTGGAAAAGTCGGCAAACCAGTCA
GGCTCGAAGATGCCCATGACGCCCTTCACTCGCCAGGACTTTGAGCAGCGCGGCGTCCGAAGCGCCGCGCCGACT
CCGGACACGGCGCACCCGTCGAGGAAGCACCTCTTCTGGGGCTCGCAGGAAGAGGATGACGAGGACAAGGACGAG
GACGAGGACGAAGAAGCCGATCCGGACCACGCTTCTCAACCGCAACCGGGTCAGAGCGACTTCCAGACCTGGTTT
TGGGAGAATAGGCGTGAGCTGAATCGCTCGTGGATGACGCGCCGGAAGACGGCGGCAAAGGAGAAGCGGCATCGG
GAGAATAAGGCGAGGACGTCGAGAGCCGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail