Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2493
Gene name
Locationscaffold_206:7176..10388
Strand-
Gene length (bp)3212
Transcript length (bp)2655
Coding sequence length (bp)2652
Protein length (aa) 884

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.0E-166 145 848

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 47 870 8.0E-141
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 38 884 1.0E-140
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 124 884 5.0E-117
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 105 860 3.0E-109
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 124 875 1.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 47 870 8.0E-141
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 38 884 1.0E-140
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 124 884 5.0E-117
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 105 860 3.0E-109
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 124 875 1.0E-108
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 125 877 2.0E-107
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 36 884 2.0E-106
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 99 868 4.0E-106
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 108 872 1.0E-103
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 124 873 6.0E-102
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 129 873 7.0E-94
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 129 873 3.0E-93
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 129 873 2.0E-89
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 101 880 7.0E-86
[Show less]

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:1904680 peptide transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0042887 amide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 258 280 22
2 330 352 22
3 403 425 22
4 476 498 22
5 570 592 22
6 599 621 22
7 680 702 22
8 750 772 22
9 792 814 22
10 827 849 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2493
MEKGLGCGGDKAGDEIKKGNKASILENIPTEDAEPAHSLRSEPSARVNNDVLEARELAASMSLESVHVMMKKVLT
DHENDPNFNYTTIQLIKTFLSNEDIVKNPEKHERLVERIKLEAALIATNSPYAEVRANVDNHDDPSMPVSTIRAW
TLGCLFSVLLSFVNQLFSIRQPSIRFETNIAQLLSYPLGKCWERWMPRYEIAIPFSGQKINLNPGPFNKKEHMLI
AIMANTSKSLPYTNFMIWTQVLPQYFNQQYARSAGYIFLNAFATNFIGYGLAGIMRKILVKPVYCIWPTAFSTIA
LNAALHPSVEDERTVAGPWRTTWSISRYRFFLYTFCAMFIYFWFPNYLFQTLSYFSWMTWIAPNNLKLNVLTGMQ
NGLGLLNPLPTFDWNFISFVTDPLMIPAFTTFNAVGGMFLTGLLIPIVWFTNTWNTGFMPIITNRVHDHFGKLYR
VSNTLDSRGMFDAEKYAKYSQPYLGAANALAYGWHFAIYTAIITHVVLYHRTQVIMGFKSIFNCLRSLRKTKVRG
ASHRANEEGYSDVHNRLMSAYPESKSARSSELASLNADQVAPPVPEWWFCTILVISVVLGILGIVLWPTYTSPAV
VLYGILLCLIFIVPVGVIVSMTGLEITLNVLAEFIGGVIVEGNALAMNFFKSYGYITCAHAISFLQDLKIAHYVK
LPPRVTFMGQMVATLISTIVCTGVFKFQMNIKDVCTSAASMRFFCPGPNTFMTASVLWGTIGPIKVFGKDGYYKW
LLMGFPVGFILVTLIWGLQRIWPDSHVLRRVNAVVAIAGSLHWAPYNFSYAWPAVPVAWFSWIYVRERYLNFWSR
YNYVLSASLSAGVAISAIVMLFSVQWAGITVDWWGNTQPFQGCEGKPCRLYTLAEGERF
Coding >Ophio5|2493
ATGGAGAAAGGCCTCGGATGCGGCGGAGACAAAGCTGGGGACGAGATCAAGAAGGGTAACAAGGCGTCCATTCTG
GAGAACATCCCCACAGAAGATGCCGAGCCAGCGCACAGCCTGAGGTCGGAGCCCTCAGCCAGAGTTAACAATGAT
GTTCTCGAGGCCAGGGAGCTGGCAGCCTCCATGAGCCTGGAGAGTGTCCATGTTATGATGAAAAAAGTTCTGACA
GACCATGAAAACGATCCCAATTTCAACTACACGACGATTCAGCTTATCAAGACTTTCCTCTCCAACGAGGACATA
GTGAAGAATCCGGAGAAGCACGAACGACTGGTGGAGCGGATCAAGCTCGAGGCGGCGCTCATTGCGACGAATAGC
CCATACGCCGAGGTCCGAGCCAATGTCGACAATCACGATGACCCAAGTATGCCCGTCTCTACCATCCGTGCTTGG
ACACTGGGCTGTCTCTTTAGCGTGCTTCTCTCCTTTGTCAATCAGCTATTTTCCATCAGGCAGCCGTCGATCCGG
TTCGAGACCAATATCGCCCAGCTGCTGTCCTATCCGCTCGGCAAGTGCTGGGAGAGGTGGATGCCGCGATACGAG
ATTGCCATCCCCTTTTCCGGCCAGAAGATCAACCTGAACCCCGGCCCGTTCAATAAGAAGGAGCATATGCTCATC
GCCATCATGGCCAATACGTCGAAAAGTCTGCCTTACACCAACTTTATGATTTGGACGCAAGTGCTTCCTCAGTAC
TTTAACCAGCAGTATGCCCGTAGCGCCGGCTACATCTTCTTGAATGCCTTTGCTACAAACTTCATCGGCTATGGC
CTCGCTGGCATCATGAGAAAGATTCTGGTGAAGCCGGTATATTGCATATGGCCTACGGCTTTCTCTACCATTGCC
CTCAACGCCGCGCTACATCCGAGTGTTGAGGACGAACGGACGGTGGCTGGCCCATGGAGAACGACGTGGTCGATA
TCACGCTACCGCTTCTTTTTGTACACTTTCTGTGCCATGTTTATCTATTTCTGGTTCCCCAACTATCTGTTCCAG
ACGCTCTCCTACTTTTCCTGGATGACATGGATCGCACCGAATAACCTGAAGCTAAATGTCTTGACTGGTATGCAG
AACGGTCTTGGGTTGTTGAACCCGCTGCCTACCTTTGACTGGAACTTCATCAGCTTCGTCACCGATCCACTGATG
ATTCCCGCCTTCACGACGTTCAACGCCGTCGGGGGAATGTTCTTGACCGGGCTCCTCATCCCCATCGTGTGGTTT
ACCAATACCTGGAACACAGGCTTTATGCCCATCATCACAAACCGAGTCCACGACCATTTCGGCAAGTTATACAGA
GTTTCCAACACGCTCGACTCTCGCGGAATGTTCGATGCCGAAAAGTATGCCAAATACTCTCAGCCGTACCTCGGA
GCTGCGAACGCACTTGCATACGGTTGGCACTTTGCCATCTATACCGCCATCATTACCCATGTTGTACTATATCAT
CGTACCCAAGTGATTATGGGATTCAAGAGCATTTTCAATTGTCTCCGATCTCTCAGAAAAACGAAGGTGAGGGGC
GCGAGCCATAGAGCCAATGAGGAAGGGTATTCGGATGTTCATAACCGCTTGATGTCGGCATATCCCGAGAGTAAG
TCTGCTAGATCGTCGGAGCTTGCGTCATTGAACGCTGACCAAGTTGCTCCTCCAGTCCCTGAGTGGTGGTTCTGC
ACCATTTTGGTCATCTCGGTCGTGCTGGGCATCCTTGGCATCGTCCTGTGGCCGACCTACACCTCCCCGGCAGTC
GTCTTATACGGCATTCTACTGTGCCTCATCTTCATCGTTCCGGTCGGCGTCATAGTTAGCATGACGGGACTTGAA
ATCACACTCAATGTCCTTGCCGAGTTCATTGGAGGCGTCATTGTCGAGGGTAATGCGTTGGCCATGAACTTTTTC
AAGTCTTATGGCTACATCACATGCGCTCACGCTATTTCCTTTCTGCAAGACCTTAAGATTGCCCATTATGTCAAG
CTGCCTCCACGAGTCACCTTTATGGGGCAAATGGTGGCCACGCTCATCTCAACCATCGTTTGCACGGGTGTCTTC
AAGTTTCAGATGAACATCAAGGATGTTTGCACCTCGGCCGCGTCCATGAGATTCTTCTGTCCCGGTCCCAACACT
TTCATGACCGCCTCAGTTCTCTGGGGAACAATCGGCCCGATAAAGGTCTTCGGGAAGGATGGCTACTATAAGTGG
TTGCTGATGGGCTTTCCCGTCGGCTTCATCCTCGTCACCTTGATCTGGGGGTTGCAGAGAATTTGGCCTGACTCG
CATGTCCTGCGTCGAGTCAACGCCGTCGTGGCGATTGCCGGCTCATTGCATTGGGCGCCTTACAACTTCTCTTAT
GCCTGGCCTGCGGTGCCTGTCGCCTGGTTCTCATGGATCTACGTCCGAGAGCGTTACCTGAACTTTTGGTCCAGG
TACAACTATGTCCTCTCGGCGTCATTATCAGCCGGTGTTGCCATATCCGCCATCGTCATGCTCTTCAGTGTCCAG
TGGGCGGGCATCACGGTCGACTGGTGGGGAAACACGCAGCCCTTCCAGGGATGCGAGGGCAAGCCTTGCAGACTG
TACACCCTGGCTGAGGGCGAGCGGTTT
Transcript >Ophio5|2493
ATGGAGAAAGGCCTCGGATGCGGCGGAGACAAAGCTGGGGACGAGATCAAGAAGGGTAACAAGGCGTCCATTCTG
GAGAACATCCCCACAGAAGATGCCGAGCCAGCGCACAGCCTGAGGTCGGAGCCCTCAGCCAGAGTTAACAATGAT
GTTCTCGAGGCCAGGGAGCTGGCAGCCTCCATGAGCCTGGAGAGTGTCCATGTTATGATGAAAAAAGTTCTGACA
GACCATGAAAACGATCCCAATTTCAACTACACGACGATTCAGCTTATCAAGACTTTCCTCTCCAACGAGGACATA
GTGAAGAATCCGGAGAAGCACGAACGACTGGTGGAGCGGATCAAGCTCGAGGCGGCGCTCATTGCGACGAATAGC
CCATACGCCGAGGTCCGAGCCAATGTCGACAATCACGATGACCCAAGTATGCCCGTCTCTACCATCCGTGCTTGG
ACACTGGGCTGTCTCTTTAGCGTGCTTCTCTCCTTTGTCAATCAGCTATTTTCCATCAGGCAGCCGTCGATCCGG
TTCGAGACCAATATCGCCCAGCTGCTGTCCTATCCGCTCGGCAAGTGCTGGGAGAGGTGGATGCCGCGATACGAG
ATTGCCATCCCCTTTTCCGGCCAGAAGATCAACCTGAACCCCGGCCCGTTCAATAAGAAGGAGCATATGCTCATC
GCCATCATGGCCAATACGTCGAAAAGTCTGCCTTACACCAACTTTATGATTTGGACGCAAGTGCTTCCTCAGTAC
TTTAACCAGCAGTATGCCCGTAGCGCCGGCTACATCTTCTTGAATGCCTTTGCTACAAACTTCATCGGCTATGGC
CTCGCTGGCATCATGAGAAAGATTCTGGTGAAGCCGGTATATTGCATATGGCCTACGGCTTTCTCTACCATTGCC
CTCAACGCCGCGCTACATCCGAGTGTTGAGGACGAACGGACGGTGGCTGGCCCATGGAGAACGACGTGGTCGATA
TCACGCTACCGCTTCTTTTTGTACACTTTCTGTGCCATGTTTATCTATTTCTGGTTCCCCAACTATCTGTTCCAG
ACGCTCTCCTACTTTTCCTGGATGACATGGATCGCACCGAATAACCTGAAGCTAAATGTCTTGACTGGTATGCAG
AACGGTCTTGGGTTGTTGAACCCGCTGCCTACCTTTGACTGGAACTTCATCAGCTTCGTCACCGATCCACTGATG
ATTCCCGCCTTCACGACGTTCAACGCCGTCGGGGGAATGTTCTTGACCGGGCTCCTCATCCCCATCGTGTGGTTT
ACCAATACCTGGAACACAGGCTTTATGCCCATCATCACAAACCGAGTCCACGACCATTTCGGCAAGTTATACAGA
GTTTCCAACACGCTCGACTCTCGCGGAATGTTCGATGCCGAAAAGTATGCCAAATACTCTCAGCCGTACCTCGGA
GCTGCGAACGCACTTGCATACGGTTGGCACTTTGCCATCTATACCGCCATCATTACCCATGTTGTACTATATCAT
CGTACCCAAGTGATTATGGGATTCAAGAGCATTTTCAATTGTCTCCGATCTCTCAGAAAAACGAAGGTGAGGGGC
GCGAGCCATAGAGCCAATGAGGAAGGGTATTCGGATGTTCATAACCGCTTGATGTCGGCATATCCCGAGAGTAAG
TCTGCTAGATCGTCGGAGCTTGCGTCATTGAACGCTGACCAAGTTGCTCCTCCAGTCCCTGAGTGGTGGTTCTGC
ACCATTTTGGTCATCTCGGTCGTGCTGGGCATCCTTGGCATCGTCCTGTGGCCGACCTACACCTCCCCGGCAGTC
GTCTTATACGGCATTCTACTGTGCCTCATCTTCATCGTTCCGGTCGGCGTCATAGTTAGCATGACGGGACTTGAA
ATCACACTCAATGTCCTTGCCGAGTTCATTGGAGGCGTCATTGTCGAGGGTAATGCGTTGGCCATGAACTTTTTC
AAGTCTTATGGCTACATCACATGCGCTCACGCTATTTCCTTTCTGCAAGACCTTAAGATTGCCCATTATGTCAAG
CTGCCTCCACGAGTCACCTTTATGGGGCAAATGGTGGCCACGCTCATCTCAACCATCGTTTGCACGGGTGTCTTC
AAGTTTCAGATGAACATCAAGGATGTTTGCACCTCGGCCGCGTCCATGAGATTCTTCTGTCCCGGTCCCAACACT
TTCATGACCGCCTCAGTTCTCTGGGGAACAATCGGCCCGATAAAGGTCTTCGGGAAGGATGGCTACTATAAGTGG
TTGCTGATGGGCTTTCCCGTCGGCTTCATCCTCGTCACCTTGATCTGGGGGTTGCAGAGAATTTGGCCTGACTCG
CATGTCCTGCGTCGAGTCAACGCCGTCGTGGCGATTGCCGGCTCATTGCATTGGGCGCCTTACAACTTCTCTTAT
GCCTGGCCTGCGGTGCCTGTCGCCTGGTTCTCATGGATCTACGTCCGAGAGCGTTACCTGAACTTTTGGTCCAGG
TACAACTATGTCCTCTCGGCGTCATTATCAGCCGGTGTTGCCATATCCGCCATCGTCATGCTCTTCAGTGTCCAG
TGGGCGGGCATCACGGTCGACTGGTGGGGAAACACGCAGCCCTTCCAGGGATGCGAGGGCAAGCCTTGCAGACTG
TACACCCTGGCTGAGGGCGAGCGGTTTTAA
Gene >Ophio5|2493
ATGGAGAAAGGCCTCGGATGCGGCGGAGACAAAGCTGGGGACGAGATCAAGAAGGGTAACAAGGCGTCCATTCTG
GAGAACATCGTCAGTCTTTCGTTCCACTCTCCAACTGCGGGAAAAAAAAAGGAAAAAGAAGAAAAATAATTGGCT
CGCCATCAGGTCTTGATATTGACTCTTGTTGGCAACAGCCCACAGAAGATGCCGAGCCAGCGCACAGCCTGAGGT
CGGAGCCCTCAGCCAGAGTTAACAGTATGTGTTTGGGTTAACATTGATCGGCAGACACCCTACCGCTACCGAAGA
TGATGTTCTCGAGGCCAGGGAGCTGGCAGCCTCCATGAGCCTGGAGAGTGTCCATGTTGTCCGTCTTTTTTTTTT
TTTTTCTTCTCCAGCACATCAACTTTAGCTTACGTGTCTAACATGGCTTAGATGATGAAAAAAGTTCTGACAGAC
CATGAAAACGATCCCAATTTCAACTACACGACGATTCAGCTTATCAAGACTTTCCTCTGTAGGAGGCTCCTCGGC
CCTGTCATGCTCCCCTTTTCGCTGACGTCAAATCTGGCAGCCAACGAGGACATAGTGAAGAATCCGGAGAAGCAC
GAACGACTGGTGGAGCGGATCAAGCTCGAGGCGGCGCTCATTGCGACGAATAGCCCATACGCCGAGGTCCGAGCC
AATGTCGACAATCACGATGACCCAAGTATGCCCGTCTCTACCATCCGTGCTTGGACACTGGGCTGTCTCTTTAGC
GTGCTTCTCTCCTTTGTCAATCAGCTATTTTCCATCAGGCAGCCGTCGATCCGGTTCGAGACCAATATCGCCCAG
CTGCTGTCCTATCCGCTCGGCAAGTGCTGGGAGAGGTGGATGCCGCGATACGAGATTGCCATCCCCTTTTCCGGC
CAGAAGATCAACCTGAACCCCGGCCCGTTCAATAAGAAGGAGCATATGCTCATCGCCATCATGGCCAATACGTCG
AAAAGTCTGCCTTACACCAACTTTATGATTTGGACGCAAGTGCTTCCTCAGTACTTTAACCAGCAGTATGCCCGT
AGCGCCGGCTACATCTTCTTGAATGCCTTTGCTACAAACTTCATCGGCTATGGCCTCGCTGGCATCATGAGAAAG
ATTCTGGTGAAGCCGGTATATTGCATATGGCCTACGGCTTTCTCTACCATTGCCCTCAACGCCGCGCTACATCCG
AGTGTTGAGGACGAACGGACGGTGGCTGGCCCATGGAGAACGACGTGGTCGATATCACGCTACCGCTTCTTTTTG
TACACTTTCTGTGCCATGTTTATCTATTTCTGGTTCCCCAACTATCTGTTCCAGACGCTCTCCTACTTTTCCTGG
ATGACATGGATCGCACCGAATAACCTGAAGCTAAATGTCTTGACTGGTATGCAGAACGGTCTTGGGGTAGGGGAT
TCATTCCGGCTTCTCCCATCAACATATTCGAGATGCTGACACGGCCATCAGTTGTTGAACCCGCTGCCTACCTTT
GACTGGAACTTCATCAGCTTCGTCACCGATCCACTGGTTCGTTTACTCCGTCTGCAAGCTGTGTGCCCTCGAGGT
CTGATACATCATGATAGATGATTCCCGCCTTCACGACGTTCAACGCCGTCGGGGGAATGTTCTTGACCGGGCTCC
TCATCCCCATCGTGTGGTTTACCAATACCTGGAACACAGGCTTTATGCCCATCATCACAAACCGAGTCCACGACC
ATTTCGGCAAGTTATACAGAGTTTCCAACACGCTCGACTCTCGCGGAATGTTCGATGCCGAAAAGTATGCCAAAT
ACTCTCAGCCGTACCTCGGAGCTGCGAACGCACTTGCATACGGTTGGCACTTTGCCATCTATACCGCCATCATTA
CCCATGTTGTACTATATCATCGTACCCAAGTGATTATGGGATTCAAGAGCATTTTCAATTGTCTCCGATCTCTCA
GAAAAACGAAGGTGAGGGGCGCGAGCCATAGAGCCAATGAGGAAGGGTATTCGGATGTTCATAACCGCTTGATGT
CGGCATATCCCGAGAGTAAGTCTGCTAGATCGTCGGAGCTTGCGTCATTGAACGCTGACCAAGTTGCTCCTCCAG
TCCCTGAGTGGTGGTTCTGCACCATTTTGGTCATCTCGGTCGTGCTGGGCATCCTTGGCATCGTCCTGTGGCCGA
CCTACACCTCCCCGGCAGTCGTCTTATACGGCATTCTACTGTGCCTCATCTTCATCGTTCCGGTCGGCGTCATAG
TTAGCATGACGGGACTTGAAATCACACTCAATGTCCTTGCCGAGTTCATTGGAGGCGTCATTGTCGAGGGTAATG
CGTTGGCCATGAACTTTTTCAAGTCTTATGGGTAAGCCATGACGCATCTTGTGGCTGTCGCGCATCTATCTAATC
GGGTATATCCTCAGCTACATCACATGCGCTCACGCTATTTCCTTTCTGCAAGACCTTAAGATTGCCCATTATGTC
AAGGTAAGGCTCATCAGCCCTTTGTTTGCCTAAAAGCTCTGGGCTAATGGTCAGCAGCTGCCTCCACGAGTCACC
TTTATGGGGCAAATGGTGGCCACGCTCATCTCAACCATCGTTTGCACGGGTGTCTTCAAGTTTCAGGTATTGAAA
AACCTACGGTTTGGTTGATAAGGCCTAGCTAAGCCTCGCAGATGAACATCAAGGATGTTTGCACCTCGGCCGCGT
CCATGAGATTCTTCTGTCCCGGTCCCAACACTTTCATGACCGCCTCAGTTCTCTGGGGAACAATCGGCCCGATAA
AGGTCTTCGGGAAGGATGGCTACTATAAGTGGTTGCTGATGGGCTTTCCCGTCGGCTTCATCCTCGTCACCTTGA
TCTGGGGGTTGCAGAGAATTTGGCCTGACTCGCATGTCCTGCGTCGAGTCAACGCCGTCGTGGCGATTGCCGGCT
CATTGCATTGGGCGCCTTACAACTTCTCTTATGCCTGGCCTGCGGTGCCTGTCGCCTGGTTCTCATGGATCTACG
TCCGAGAGCGTTACCTGAACTTTTGGTCCAGGTACAACTATGTCCTCTCGGCGTCATTATCAGCCGGTGTTGCCA
TATCCGCCATCGTCATGCTCTTCAGTGTCCAGTGGGCGGGCATCACGGTCGACTGGTGGGGAAACACGCAGCCCT
TCCAGGGATGCGAGGGCAAGCCTTGCAGACTGTACACCCTGGCTGAGGGCGAGCGGTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail