Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2490
Gene name
Locationscaffold_206:622..2787
Strand-
Gene length (bp)2165
Transcript length (bp)2040
Coding sequence length (bp)2037
Protein length (aa) 679

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03109 ABC1 ABC1 atypical kinase-like domain 1.5E-09 191 243
PF03109 ABC1 ABC1 atypical kinase-like domain 2.3E-32 285 431

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02981|YP109_YEAST ABC1 family protein YPL109C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL109C PE=1 SV=2 63 678 6.0E-161
sp|Q9P7M0|YOS3_SCHPO ABC1 family protein C21C3.03, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.03 PE=3 SV=2 115 679 2.0E-149
sp|Q55G83|ABKC_DICDI Probable serine/threonine-protein kinase abkC OS=Dictyostelium discoideum GN=abkC PE=3 SV=1 113 640 3.0E-84
sp|Q6NSR3|ADCK2_MOUSE Uncharacterized aarF domain-containing protein kinase 2 OS=Mus musculus GN=Adck2 PE=2 SV=1 113 627 1.0E-67
sp|Q7Z695|ADCK2_HUMAN Uncharacterized aarF domain-containing protein kinase 2 OS=Homo sapiens GN=ADCK2 PE=2 SV=1 149 627 2.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02981|YP109_YEAST ABC1 family protein YPL109C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL109C PE=1 SV=2 63 678 6.0E-161
sp|Q9P7M0|YOS3_SCHPO ABC1 family protein C21C3.03, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.03 PE=3 SV=2 115 679 2.0E-149
sp|Q55G83|ABKC_DICDI Probable serine/threonine-protein kinase abkC OS=Dictyostelium discoideum GN=abkC PE=3 SV=1 113 640 3.0E-84
sp|Q6NSR3|ADCK2_MOUSE Uncharacterized aarF domain-containing protein kinase 2 OS=Mus musculus GN=Adck2 PE=2 SV=1 113 627 1.0E-67
sp|Q7Z695|ADCK2_HUMAN Uncharacterized aarF domain-containing protein kinase 2 OS=Homo sapiens GN=ADCK2 PE=2 SV=1 149 627 2.0E-61
sp|A0L1M6|UBIB_SHESA Probable protein kinase UbiB OS=Shewanella sp. (strain ANA-3) GN=ubiB PE=3 SV=1 159 633 1.0E-33
sp|Q0HZP9|UBIB_SHESR Probable protein kinase UbiB OS=Shewanella sp. (strain MR-7) GN=ubiB PE=3 SV=1 159 633 1.0E-33
sp|Q0HE99|UBIB_SHESM Probable protein kinase UbiB OS=Shewanella sp. (strain MR-4) GN=ubiB PE=3 SV=1 159 633 3.0E-33
sp|Q9CKD4|UBIB_PASMU Probable protein kinase UbiB OS=Pasteurella multocida (strain Pm70) GN=ubiB PE=3 SV=1 133 650 4.0E-33
sp|A1RP80|UBIB_SHESW Probable protein kinase UbiB OS=Shewanella sp. (strain W3-18-1) GN=ubiB PE=3 SV=1 159 633 1.0E-32
sp|A4Y2Q3|UBIB_SHEPC Probable protein kinase UbiB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiB PE=3 SV=1 159 633 1.0E-32
sp|Q8E9R5|UBIB_SHEON Probable protein kinase UbiB OS=Shewanella oneidensis (strain MR-1) GN=ubiB PE=3 SV=1 126 634 2.0E-32
sp|A1U669|UBIB_MARHV Probable protein kinase UbiB OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ubiB PE=3 SV=1 159 627 1.0E-31
sp|A9KYL6|UBIB_SHEB9 Probable protein kinase UbiB OS=Shewanella baltica (strain OS195) GN=ubiB PE=3 SV=1 159 632 1.0E-31
sp|A6WIE7|UBIB_SHEB8 Probable protein kinase UbiB OS=Shewanella baltica (strain OS185) GN=ubiB PE=3 SV=1 159 632 1.0E-31
sp|B1KR05|UBIB_SHEWM Probable protein kinase UbiB OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiB PE=3 SV=1 133 635 2.0E-31
sp|Q0I208|UBIB_HAES1 Probable protein kinase UbiB OS=Haemophilus somnus (strain 129Pt) GN=ubiB PE=3 SV=1 133 639 3.0E-31
sp|A3D9F4|UBIB_SHEB5 Probable protein kinase UbiB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiB PE=3 SV=1 159 632 6.0E-31
sp|B8E6B4|UBIB_SHEB2 Probable protein kinase UbiB OS=Shewanella baltica (strain OS223) GN=ubiB PE=3 SV=1 159 632 6.0E-31
sp|Q088I0|UBIB_SHEFN Probable protein kinase UbiB OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiB PE=3 SV=1 159 637 2.0E-30
sp|A1SAK0|UBIB_SHEAM Probable protein kinase UbiB OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiB PE=3 SV=1 138 635 4.0E-30
sp|Q9JVQ5|UBIB_NEIMA Probable protein kinase UbiB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ubiB PE=3 SV=1 159 430 4.0E-29
sp|Q9K0N0|UBIB_NEIMB Probable protein kinase UbiB OS=Neisseria meningitidis serogroup B (strain MC58) GN=ubiB PE=3 SV=1 159 430 6.0E-29
sp|Q12S25|UBIB_SHEDO Probable protein kinase UbiB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiB PE=3 SV=1 138 634 6.0E-29
sp|A0KEF8|UBIB_AERHH Probable protein kinase UbiB OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ubiB PE=3 SV=1 159 438 9.0E-29
sp|B8CI04|UBIB_SHEPW Probable protein kinase UbiB OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ubiB PE=3 SV=1 133 642 5.0E-28
sp|C4L962|UBIB_TOLAT Probable protein kinase UbiB OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ubiB PE=3 SV=1 156 439 1.0E-27
sp|A8H968|UBIB_SHEPA Probable protein kinase UbiB OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiB PE=3 SV=1 159 634 5.0E-27
sp|A4STK9|UBIB_AERS4 Probable protein kinase UbiB OS=Aeromonas salmonicida (strain A449) GN=ubiB PE=3 SV=1 159 438 5.0E-27
sp|O07443|UBIB_PROST Probable protein kinase UbiB OS=Providencia stuartii GN=ubiB PE=1 SV=1 164 672 5.0E-27
sp|A3QIE3|UBIB_SHELP Probable protein kinase UbiB OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ubiB PE=3 SV=1 159 634 1.0E-26
sp|Q3BZ34|UBIB_XANC5 Probable protein kinase UbiB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiB PE=3 SV=1 164 630 2.0E-26
sp|B8F6K1|UBIB_HAEPS Probable protein kinase UbiB OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=ubiB PE=3 SV=1 164 439 2.0E-26
sp|Q6DAQ5|UBIB_PECAS Probable protein kinase UbiB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ubiB PE=3 SV=1 159 635 3.0E-26
sp|Q7VN62|UBIB_HAEDU Probable protein kinase UbiB OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiB PE=3 SV=1 159 635 3.0E-26
sp|B0TJ18|UBIB_SHEHH Probable protein kinase UbiB OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiB PE=3 SV=1 159 634 4.0E-26
sp|Q8PQT0|UBIB_XANAC Probable protein kinase UbiB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiB PE=3 SV=1 164 630 5.0E-26
sp|B7LTZ9|UBIB_ESCF3 Probable protein kinase UbiB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ubiB PE=3 SV=1 164 673 7.0E-26
sp|A6VDI8|UBIB_PSEA7 Probable protein kinase UbiB OS=Pseudomonas aeruginosa (strain PA7) GN=ubiB PE=3 SV=1 128 627 8.0E-26
sp|Q8PDW1|UBIB_XANCP Probable protein kinase UbiB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiB PE=3 SV=1 164 630 1.0E-25
sp|Q4V052|UBIB_XANC8 Probable protein kinase UbiB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiB PE=3 SV=1 164 630 1.0E-25
sp|B0RLZ0|UBIB_XANCB Probable protein kinase UbiB OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiB PE=3 SV=1 164 630 2.0E-25
sp|Q02EV2|UBIB_PSEAB Probable protein kinase UbiB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiB PE=3 SV=1 164 627 2.0E-25
sp|B7V3F8|UBIB_PSEA8 Probable protein kinase UbiB OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiB PE=3 SV=1 164 627 2.0E-25
sp|Q9HUB8|UBIB_PSEAE Probable protein kinase UbiB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiB PE=3 SV=1 164 627 2.0E-25
sp|Q5H616|UBIB_XANOR Probable protein kinase UbiB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiB PE=3 SV=1 164 630 2.0E-25
sp|B2ST34|UBIB_XANOP Probable protein kinase UbiB OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiB PE=3 SV=1 164 630 2.0E-25
sp|Q2P8Q0|UBIB_XANOM Probable protein kinase UbiB OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiB PE=3 SV=1 164 630 2.0E-25
sp|Q2SN14|UBIB_HAHCH Probable protein kinase UbiB OS=Hahella chejuensis (strain KCTC 2396) GN=ubiB PE=3 SV=1 156 636 2.0E-25
sp|C6DI75|UBIB_PECCP Probable protein kinase UbiB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ubiB PE=3 SV=1 159 627 3.0E-25
sp|Q6LVW8|UBIB_PHOPR Probable protein kinase UbiB OS=Photobacterium profundum GN=ubiB PE=3 SV=1 164 640 3.0E-25
sp|C1DHS4|UBIB_AZOVD Probable protein kinase UbiB OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiB PE=3 SV=1 164 627 3.0E-25
sp|P0A197|UBIB_SALTY Probable protein kinase UbiB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|P0A198|UBIB_SALTI Probable protein kinase UbiB OS=Salmonella typhi GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|B4TNY1|UBIB_SALSV Probable protein kinase UbiB OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|B5BIY1|UBIB_SALPK Probable protein kinase UbiB OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|C0Q3E3|UBIB_SALPC Probable protein kinase UbiB OS=Salmonella paratyphi C (strain RKS4594) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|A9MY99|UBIB_SALPB Probable protein kinase UbiB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|Q5PKP2|UBIB_SALPA Probable protein kinase UbiB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|B4SZ75|UBIB_SALNS Probable protein kinase UbiB OS=Salmonella newport (strain SL254) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|B4TBR5|UBIB_SALHS Probable protein kinase UbiB OS=Salmonella heidelberg (strain SL476) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|B5FNW8|UBIB_SALDC Probable protein kinase UbiB OS=Salmonella dublin (strain CT_02021853) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|Q57HN6|UBIB_SALCH Probable protein kinase UbiB OS=Salmonella choleraesuis (strain SC-B67) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|B5EZV0|UBIB_SALA4 Probable protein kinase UbiB OS=Salmonella agona (strain SL483) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|A7MQL5|UBIB_CROS8 Probable protein kinase UbiB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiB PE=3 SV=1 139 627 4.0E-25
sp|B7VHC3|UBIB_VIBTL Probable protein kinase UbiB OS=Vibrio tasmaniensis (strain LGP32) GN=ubiB PE=3 SV=1 125 627 6.0E-25
sp|A8ACY4|UBIB_CITK8 Probable protein kinase UbiB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiB PE=3 SV=1 164 673 7.0E-25
sp|B5QW75|UBIB_SALEP Probable protein kinase UbiB OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiB PE=3 SV=1 164 668 8.0E-25
sp|B5RFM6|UBIB_SALG2 Probable protein kinase UbiB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiB PE=3 SV=1 164 668 8.0E-25
sp|Q7MZ83|UBIB_PHOLL Probable protein kinase UbiB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiB PE=3 SV=1 164 635 9.0E-25
sp|Q7NZD1|UBIB_CHRVO Probable protein kinase UbiB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiB PE=3 SV=1 159 430 1.0E-24
sp|C5CWY2|UBIB_VARPS Probable protein kinase UbiB OS=Variovorax paradoxus (strain S110) GN=ubiB PE=3 SV=1 156 430 1.0E-24
sp|A7MTX4|UBIB_VIBCB Probable protein kinase UbiB OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiB PE=3 SV=1 164 629 2.0E-24
sp|B1LM23|UBIB_ECOSM Probable protein kinase UbiB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|A3N3S2|UBIB_ACTP2 Probable protein kinase UbiB OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiB PE=3 SV=1 159 439 2.0E-24
sp|Q4KJL4|UBIB_PSEF5 Probable protein kinase UbiB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ubiB PE=3 SV=1 164 627 2.0E-24
sp|A4WFY3|UBIB_ENT38 Probable protein kinase UbiB OS=Enterobacter sp. (strain 638) GN=ubiB PE=3 SV=1 164 627 2.0E-24
sp|Q3YVD0|UBIB_SHISS Probable protein kinase UbiB OS=Shigella sonnei (strain Ss046) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|Q1R475|UBIB_ECOUT Probable protein kinase UbiB OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|Q8FBI8|UBIB_ECOL6 Probable protein kinase UbiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|Q0TAL9|UBIB_ECOL5 Probable protein kinase UbiB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|A1AI24|UBIB_ECOK1 Probable protein kinase UbiB OS=Escherichia coli O1:K1 / APEC GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|B7N2E3|UBIB_ECO81 Probable protein kinase UbiB OS=Escherichia coli O81 (strain ED1a) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|B7MHC2|UBIB_ECO45 Probable protein kinase UbiB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|B7NFD8|UBIB_ECOLU Probable protein kinase UbiB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|B7NV31|UBIB_ECO7I Probable protein kinase UbiB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|B7UNG5|UBIB_ECO27 Probable protein kinase UbiB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|C3LPS7|UBIB_VIBCM Probable protein kinase UbiB OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiB PE=3 SV=1 125 637 2.0E-24
sp|Q9KVQ4|UBIB_VIBCH Probable protein kinase UbiB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiB PE=3 SV=1 125 637 2.0E-24
sp|P0A6A2|UBIB_SHIFL Probable protein kinase UbiB OS=Shigella flexneri GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|Q0SZ27|UBIB_SHIF8 Probable protein kinase UbiB OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|Q32A13|UBIB_SHIDS Probable protein kinase UbiB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|Q31UF1|UBIB_SHIBS Probable protein kinase UbiB OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|B2TVI6|UBIB_SHIB3 Probable protein kinase UbiB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|B6I4H7|UBIB_ECOSE Probable protein kinase UbiB OS=Escherichia coli (strain SE11) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|P0A6A0|UBIB_ECOLI Probable protein kinase UbiB OS=Escherichia coli (strain K12) GN=ubiB PE=1 SV=1 164 673 3.0E-24
sp|B1IW70|UBIB_ECOLC Probable protein kinase UbiB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|A8A6U2|UBIB_ECOHS Probable protein kinase UbiB OS=Escherichia coli O9:H4 (strain HS) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|B1XAJ9|UBIB_ECODH Probable protein kinase UbiB OS=Escherichia coli (strain K12 / DH10B) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|C5A011|UBIB_ECOBW Probable protein kinase UbiB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|B7M640|UBIB_ECO8A Probable protein kinase UbiB OS=Escherichia coli O8 (strain IAI1) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|B5YY84|UBIB_ECO5E Probable protein kinase UbiB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|P0A6A1|UBIB_ECO57 Probable protein kinase UbiB OS=Escherichia coli O157:H7 GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|B7L998|UBIB_ECO55 Probable protein kinase UbiB OS=Escherichia coli (strain 55989 / EAEC) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|A7ZU42|UBIB_ECO24 Probable protein kinase UbiB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|A4XPM5|UBIB_PSEMY Probable protein kinase UbiB OS=Pseudomonas mendocina (strain ymp) GN=ubiB PE=3 SV=1 159 627 3.0E-24
sp|A5F4G3|UBIB_VIBC3 Probable protein kinase UbiB OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiB PE=3 SV=1 125 637 4.0E-24
sp|B2VG47|UBIB_ERWT9 Probable protein kinase UbiB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiB PE=3 SV=1 159 627 5.0E-24
sp|B0BU10|UBIB_ACTPJ Probable protein kinase UbiB OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ubiB PE=3 SV=1 159 439 7.0E-24
sp|Q87CN1|UBIB_XYLFT Probable protein kinase UbiB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ubiB PE=3 SV=1 159 630 1.0E-23
sp|B2I583|UBIB_XYLF2 Probable protein kinase UbiB OS=Xylella fastidiosa (strain M23) GN=ubiB PE=3 SV=1 159 630 1.0E-23
sp|B0U2R2|UBIB_XYLFM Probable protein kinase UbiB OS=Xylella fastidiosa (strain M12) GN=ubiB PE=3 SV=1 164 630 1.0E-23
sp|Q87TH2|UBIB_VIBPA Probable protein kinase UbiB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiB PE=3 SV=1 164 629 1.0E-23
sp|Q3KJC7|UBIB_PSEPF Probable protein kinase UbiB OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiB PE=3 SV=1 164 627 2.0E-23
sp|Q55884|Y095_SYNY3 Uncharacterized protein sll0095 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0095 PE=3 SV=1 156 430 2.0E-23
sp|Q9PCE8|UBIB_XYLFA Probable protein kinase UbiB OS=Xylella fastidiosa (strain 9a5c) GN=ubiB PE=3 SV=1 159 630 2.0E-23
sp|B0KM38|UBIB_PSEPG Probable protein kinase UbiB OS=Pseudomonas putida (strain GB-1) GN=ubiB PE=3 SV=1 164 627 2.0E-23
sp|Q48PJ6|UBIB_PSE14 Probable protein kinase UbiB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiB PE=3 SV=1 164 627 3.0E-23
sp|Q1I3S8|UBIB_PSEE4 Probable protein kinase UbiB OS=Pseudomonas entomophila (strain L48) GN=ubiB PE=3 SV=1 164 627 3.0E-23
sp|C3K8U2|UBIB_PSEFS Probable protein kinase UbiB OS=Pseudomonas fluorescens (strain SBW25) GN=ubiB PE=3 SV=1 164 627 4.0E-23
sp|Q8Y275|UBIB_RALSO Probable protein kinase UbiB OS=Ralstonia solanacearum (strain GMI1000) GN=ubiB PE=3 SV=1 126 430 4.0E-23
sp|Q7MQ31|UBIB_VIBVY Probable protein kinase UbiB OS=Vibrio vulnificus (strain YJ016) GN=ubiB PE=3 SV=1 164 629 4.0E-23
sp|Q87UZ0|UBIB_PSESM Probable protein kinase UbiB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiB PE=3 SV=1 164 627 6.0E-23
sp|B1J2S6|UBIB_PSEPW Probable protein kinase UbiB OS=Pseudomonas putida (strain W619) GN=ubiB PE=3 SV=1 164 644 7.0E-23
sp|A9BP42|UBIB_DELAS Probable protein kinase UbiB OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=ubiB PE=3 SV=1 156 430 1.0E-22
sp|B3GZD0|UBIB_ACTP7 Probable protein kinase UbiB OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ubiB PE=3 SV=1 159 439 2.0E-22
sp|Q8DDQ1|UBIB_VIBVU Probable protein kinase UbiB OS=Vibrio vulnificus (strain CMCP6) GN=ubiB PE=3 SV=1 164 629 2.0E-22
sp|B6EHA6|UBIB_ALISL Probable protein kinase UbiB OS=Aliivibrio salmonicida (strain LFI1238) GN=ubiB PE=3 SV=1 164 634 2.0E-22
sp|A5WA47|UBIB_PSEP1 Probable protein kinase UbiB OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiB PE=3 SV=1 164 627 2.0E-22
sp|Q4ZZG5|UBIB_PSEU2 Probable protein kinase UbiB OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiB PE=3 SV=1 164 627 3.0E-22
sp|A8G8C0|UBIB_SERP5 Probable protein kinase UbiB OS=Serratia proteamaculans (strain 568) GN=ubiB PE=3 SV=1 164 627 3.0E-22
sp|Q491V8|UBIB_BLOPB Probable protein kinase UbiB OS=Blochmannia pennsylvanicus (strain BPEN) GN=ubiB PE=3 SV=1 88 439 5.0E-22
sp|Q66FS8|UBIB_YERPS Probable protein kinase UbiB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|A4TR37|UBIB_YERPP Probable protein kinase UbiB OS=Yersinia pestis (strain Pestoides F) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|Q1CNB2|UBIB_YERPN Probable protein kinase UbiB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|A9R429|UBIB_YERPG Probable protein kinase UbiB OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|Q8ZAM1|UBIB_YERPE Probable protein kinase UbiB OS=Yersinia pestis GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|B2K0Y6|UBIB_YERPB Probable protein kinase UbiB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|Q1CBF8|UBIB_YERPA Probable protein kinase UbiB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|A7FDE2|UBIB_YERP3 Probable protein kinase UbiB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|A6TGL5|UBIB_KLEP7 Probable protein kinase UbiB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiB PE=3 SV=1 164 627 6.0E-22
sp|B1XWR5|UBIB_LEPCP Probable protein kinase UbiB OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ubiB PE=3 SV=1 156 430 6.0E-22
sp|Q63X97|UBIB_BURPS Probable protein kinase UbiB OS=Burkholderia pseudomallei (strain K96243) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|A3N5V1|UBIB_BURP6 Probable protein kinase UbiB OS=Burkholderia pseudomallei (strain 668) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|Q3JVZ2|UBIB_BURP1 Probable protein kinase UbiB OS=Burkholderia pseudomallei (strain 1710b) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|A3NRJ7|UBIB_BURP0 Probable protein kinase UbiB OS=Burkholderia pseudomallei (strain 1106a) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|A1V750|UBIB_BURMS Probable protein kinase UbiB OS=Burkholderia mallei (strain SAVP1) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|Q62MP2|UBIB_BURMA Probable protein kinase UbiB OS=Burkholderia mallei (strain ATCC 23344) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|A2S8L4|UBIB_BURM9 Probable protein kinase UbiB OS=Burkholderia mallei (strain NCTC 10229) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|A3MNU1|UBIB_BURM7 Probable protein kinase UbiB OS=Burkholderia mallei (strain NCTC 10247) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|Q2NWT9|UBIB_SODGM Probable protein kinase UbiB OS=Sodalis glossinidius (strain morsitans) GN=ubiB PE=3 SV=1 164 664 2.0E-21
sp|B5XYH9|UBIB_KLEP3 Probable protein kinase UbiB OS=Klebsiella pneumoniae (strain 342) GN=ubiB PE=3 SV=1 164 627 2.0E-21
sp|B2SX38|UBIB_BURPP Probable protein kinase UbiB OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ubiB PE=3 SV=1 159 430 3.0E-21
sp|A1JIF4|UBIB_YERE8 Probable protein kinase UbiB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiB PE=3 SV=1 159 627 8.0E-21
sp|B5FF80|UBIB_VIBFM Probable protein kinase UbiB OS=Vibrio fischeri (strain MJ11) GN=ubiB PE=3 SV=1 164 634 9.0E-21
sp|P73627|Y1770_SYNY3 Uncharacterized protein sll1770 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1770 PE=3 SV=1 164 430 1.0E-20
sp|Q145N7|UBIB_BURXL Probable protein kinase UbiB OS=Burkholderia xenovorans (strain LB400) GN=ubiB PE=3 SV=1 159 430 2.0E-20
sp|Q9D0L4|ADCK1_MOUSE Uncharacterized aarF domain-containing protein kinase 1 OS=Mus musculus GN=Adck1 PE=1 SV=1 166 431 2.0E-20
sp|Q86TW2|ADCK1_HUMAN Uncharacterized aarF domain-containing protein kinase 1 OS=Homo sapiens GN=ADCK1 PE=2 SV=2 166 431 2.0E-20
sp|B3PH50|UBIB_CELJU Probable protein kinase UbiB OS=Cellvibrio japonicus (strain Ueda107) GN=ubiB PE=3 SV=1 164 439 2.0E-20
sp|Q5E8V3|UBIB_VIBF1 Probable protein kinase UbiB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ubiB PE=3 SV=1 164 634 2.0E-20
sp|B2JCV1|UBIB_BURP8 Probable protein kinase UbiB OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ubiB PE=3 SV=1 159 430 4.0E-20
sp|Q5ZMT7|ADCK1_CHICK Uncharacterized aarF domain-containing protein kinase 1 OS=Gallus gallus GN=ADCK1 PE=2 SV=1 166 431 6.0E-20
sp|Q6INL7|ADCK1_XENLA Uncharacterized aarF domain-containing protein kinase 1 OS=Xenopus laevis GN=adck1 PE=2 SV=1 166 431 6.0E-20
sp|B9ME24|UBIB_ACIET Probable protein kinase UbiB OS=Acidovorax ebreus (strain TPSY) GN=ubiB PE=3 SV=1 156 430 2.0E-19
sp|A1W4D7|UBIB_ACISJ Probable protein kinase UbiB OS=Acidovorax sp. (strain JS42) GN=ubiB PE=3 SV=1 156 430 2.0E-19
sp|C5BCA6|UBIB_EDWI9 Probable protein kinase UbiB OS=Edwardsiella ictaluri (strain 93-146) GN=ubiB PE=3 SV=1 123 439 1.0E-18
sp|A1TTA2|UBIB_ACIAC Probable protein kinase UbiB OS=Acidovorax citrulli (strain AAC00-1) GN=ubiB PE=3 SV=1 156 430 1.0E-17
sp|Q5M7P6|ADCK1_XENTR Uncharacterized aarF domain-containing protein kinase 1 OS=Xenopus tropicalis GN=adck1 PE=2 SV=1 166 442 2.0E-17
sp|Q8RWG1|Y4139_ARATH Uncharacterized aarF domain-containing protein kinase At4g31390, chloroplastic OS=Arabidopsis thaliana GN=At4g31390 PE=2 SV=1 164 429 4.0E-17
sp|Q9MA15|Y1796_ARATH Uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic OS=Arabidopsis thaliana GN=At1g79600 PE=2 SV=1 164 429 5.0E-17
sp|P73577|Y889_SYNY3 Uncharacterized protein slr0889 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0889 PE=3 SV=1 164 429 4.0E-16
sp|Q46189|YHG1_CLOPA Uncharacterized protein in hydrogenase 1 5'region (Fragment) OS=Clostridium pasteurianum PE=3 SV=1 158 431 3.0E-15
sp|O60111|MCP2L_SCHPO ABC1 family protein MCP2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.02 PE=3 SV=2 157 431 5.0E-15
sp|Q54TR5|ABKB_DICDI Probable serine/threonine-protein kinase abkB OS=Dictyostelium discoideum GN=abkB PE=3 SV=1 167 442 6.0E-15
sp|Q06567|MCP2_YEAST ABC1 family protein MCP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCP2 PE=1 SV=1 164 437 4.0E-14
sp|Q54P00|ABKD_DICDI Probable serine/threonine-protein kinase abkD OS=Dictyostelium discoideum GN=abkD PE=2 SV=1 164 431 1.0E-13
sp|Q55680|Y005_SYNY3 Uncharacterized protein sll0005 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0005 PE=3 SV=1 118 429 2.0E-13
sp|P73121|Y1919_SYNY3 Uncharacterized protein slr1919 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1919 PE=3 SV=1 164 429 6.0E-13
sp|O42653|YF9E_SCHPO ABC1 family protein C10F6.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.14c PE=3 SV=1 156 431 7.0E-11
sp|O04212|Y2090_ARATH Putative ABC1 protein At2g40090 OS=Arabidopsis thaliana GN=At2g40090 PE=2 SV=2 164 528 2.0E-10
sp|P9WQI1|Y647_MYCTU Uncharacterized protein Rv0647c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0647c PE=1 SV=1 156 430 1.0E-06
sp|P9WQI0|Y647_MYCTO Uncharacterized protein MT0675 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0675 PE=3 SV=1 156 430 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 38 57 19
2 114 136 22
3 303 325 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 44.69 24.42 64.96
CcL In ants, during behavior modification 27.82 14.74 40.90
CcD In ants, recently dead 31.84 17.20 46.48

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.030349 yes
SC16a CcD 0.134164 no
CcL CcD 0.599845 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2490
MIRGFVLRRLFTRPTLGSGGIRLSAPWRQTRRPMARSALRASAGIAAAGMATFVELANRDNSGTDETGEHRMLEL
SRAEMNKTVSDDDRGLVRFVREAVLLFDVWIWEPICTGARFLQLVIIFVPVLAAVPALWLGRRQRHRDDERSGTL
WWYGLLVQSMEWAGPAFIKLGQWAASRSDLLPTEMCEMMSRLHSHAPAHSMRQTRETVSAAFDGRSLEDVFDEFD
ETPLGVGAIAQVYRARLKPDLMAPADADVATPHPPALSDNVRRHVDSVLKRSPQRVPSSFVAVKVLHPNVERTVR
RDLTIMGFFASILNAIPTIEWLSLPDEVAQFGAMMRLQLDLRIEAANLETFRQNFKHRSTAWFPYPYTQFTTRNL
LVEEYAHGIPLADFLENGGGVFQHDIADEGLDAFLHMLLIDNFVHADLHPGNIMVRFYQTARPELRLRRSRDKPL
PASDEDEAADVTERVLERLRPFRHRKNQAAWEAELASIDAEGYRPQLVFIDTGLVTELSETNRANFLALFRAVAE
FDGYKAGHLMCERCRQPDAVLEQEIFALKMQHLVLGVKRRTLALGAVKIGDILQRVLAMVRHHHVRLEGDFVNVV
LSILLLEGIGRSLSPDVDLLSSSLPILRQLSAQSGAEMAKQGDFSMLVVWMGLETRKFLQASVEDVERCVKSDLL
SPNV
Coding >Ophio5|2490
ATGATTAGGGGCTTCGTCTTGCGCCGGCTCTTCACCCGCCCGACTCTCGGCTCCGGAGGAATCCGACTCTCGGCC
CCATGGCGACAGACGAGACGGCCGATGGCCAGATCGGCGCTCCGGGCGTCTGCCGGCATCGCCGCTGCCGGAATG
GCAACGTTTGTTGAGCTCGCGAACCGCGACAATAGCGGCACCGACGAGACGGGCGAGCACCGCATGCTGGAGTTG
TCGCGGGCCGAGATGAACAAGACGGTGTCGGACGACGATCGGGGCTTGGTCCGCTTCGTGCGTGAGGCTGTACTG
CTATTCGATGTCTGGATCTGGGAGCCCATCTGTACGGGCGCCCGTTTCCTACAGCTGGTCATCATCTTCGTCCCC
GTCCTGGCCGCCGTGCCCGCCCTCTGGCTTGGACGTCGGCAACGGCATCGCGACGATGAGAGGAGCGGCACCCTC
TGGTGGTACGGACTCCTCGTCCAATCCATGGAATGGGCCGGCCCGGCCTTTATCAAACTCGGTCAGTGGGCAGCC
TCGCGGTCCGATCTCCTCCCGACGGAGATGTGTGAGATGATGTCGAGGCTGCACTCGCACGCGCCCGCCCACTCG
ATGCGCCAGACTCGCGAGACGGTGAGCGCCGCCTTTGACGGCCGCTCCCTGGAAGACGTCTTCGACGAATTCGAC
GAGACGCCCCTCGGCGTCGGCGCCATCGCCCAAGTCTATCGAGCGAGGCTGAAGCCCGATCTCATGGCCCCGGCC
GACGCCGACGTGGCGACGCCGCATCCGCCAGCCTTGTCGGACAACGTACGGCGGCATGTCGACTCGGTGCTCAAG
AGGTCGCCTCAGCGCGTTCCTTCGAGCTTCGTCGCCGTCAAGGTGCTGCACCCAAACGTCGAGCGCACCGTCCGA
AGGGACTTGACCATCATGGGCTTCTTCGCTTCCATCCTCAACGCCATCCCTACCATAGAGTGGCTCTCGCTCCCT
GACGAGGTGGCTCAGTTCGGCGCCATGATGCGTCTGCAGCTCGACCTGCGGATCGAAGCCGCCAATCTCGAAACG
TTCCGCCAGAACTTCAAGCACCGCTCAACCGCCTGGTTCCCGTATCCCTACACCCAGTTCACGACACGTAACCTG
CTAGTCGAGGAGTACGCCCACGGCATCCCGCTCGCCGACTTCTTGGAAAACGGCGGCGGCGTGTTCCAGCACGAC
ATCGCCGACGAGGGCCTCGACGCCTTTCTGCACATGCTGCTCATCGACAACTTCGTCCACGCAGACCTCCATCCG
GGCAACATCATGGTCCGCTTTTATCAGACGGCCCGACCCGAGTTGCGTCTCCGTAGGTCCCGCGACAAGCCTCTT
CCCGCCAGCGACGAAGACGAGGCGGCCGACGTAACGGAGCGCGTGCTCGAGCGTCTGCGACCCTTTCGCCATCGC
AAGAACCAGGCTGCGTGGGAGGCCGAGCTAGCCAGCATCGACGCCGAGGGCTATCGGCCGCAGCTCGTCTTCATC
GACACGGGCCTCGTGACGGAGCTGAGCGAGACGAACCGGGCCAACTTTCTGGCCCTGTTCCGGGCCGTGGCCGAG
TTCGACGGTTACAAAGCCGGACACCTCATGTGCGAGCGCTGCCGGCAGCCGGACGCCGTGCTGGAGCAGGAGATT
TTCGCCCTCAAGATGCAGCATCTGGTATTGGGCGTCAAGCGTCGTACGCTCGCCCTCGGCGCCGTCAAGATCGGA
GACATCCTACAGCGTGTGCTGGCCATGGTTCGCCATCACCACGTCCGTCTCGAGGGCGACTTCGTCAACGTCGTT
CTCAGCATCTTGTTGCTCGAGGGAATCGGCCGTAGTCTGAGTCCGGACGTCGACCTCCTCAGCAGCTCGTTGCCC
ATTCTTCGTCAGCTGAGCGCCCAGAGCGGTGCAGAGATGGCCAAGCAGGGCGATTTTTCCATGTTGGTCGTCTGG
ATGGGCCTTGAGACGAGAAAGTTTCTTCAAGCCAGCGTCGAGGACGTTGAACGCTGTGTCAAGTCTGATCTCTTG
TCACCCAACGTA
Transcript >Ophio5|2490
ATGATTAGGGGCTTCGTCTTGCGCCGGCTCTTCACCCGCCCGACTCTCGGCTCCGGAGGAATCCGACTCTCGGCC
CCATGGCGACAGACGAGACGGCCGATGGCCAGATCGGCGCTCCGGGCGTCTGCCGGCATCGCCGCTGCCGGAATG
GCAACGTTTGTTGAGCTCGCGAACCGCGACAATAGCGGCACCGACGAGACGGGCGAGCACCGCATGCTGGAGTTG
TCGCGGGCCGAGATGAACAAGACGGTGTCGGACGACGATCGGGGCTTGGTCCGCTTCGTGCGTGAGGCTGTACTG
CTATTCGATGTCTGGATCTGGGAGCCCATCTGTACGGGCGCCCGTTTCCTACAGCTGGTCATCATCTTCGTCCCC
GTCCTGGCCGCCGTGCCCGCCCTCTGGCTTGGACGTCGGCAACGGCATCGCGACGATGAGAGGAGCGGCACCCTC
TGGTGGTACGGACTCCTCGTCCAATCCATGGAATGGGCCGGCCCGGCCTTTATCAAACTCGGTCAGTGGGCAGCC
TCGCGGTCCGATCTCCTCCCGACGGAGATGTGTGAGATGATGTCGAGGCTGCACTCGCACGCGCCCGCCCACTCG
ATGCGCCAGACTCGCGAGACGGTGAGCGCCGCCTTTGACGGCCGCTCCCTGGAAGACGTCTTCGACGAATTCGAC
GAGACGCCCCTCGGCGTCGGCGCCATCGCCCAAGTCTATCGAGCGAGGCTGAAGCCCGATCTCATGGCCCCGGCC
GACGCCGACGTGGCGACGCCGCATCCGCCAGCCTTGTCGGACAACGTACGGCGGCATGTCGACTCGGTGCTCAAG
AGGTCGCCTCAGCGCGTTCCTTCGAGCTTCGTCGCCGTCAAGGTGCTGCACCCAAACGTCGAGCGCACCGTCCGA
AGGGACTTGACCATCATGGGCTTCTTCGCTTCCATCCTCAACGCCATCCCTACCATAGAGTGGCTCTCGCTCCCT
GACGAGGTGGCTCAGTTCGGCGCCATGATGCGTCTGCAGCTCGACCTGCGGATCGAAGCCGCCAATCTCGAAACG
TTCCGCCAGAACTTCAAGCACCGCTCAACCGCCTGGTTCCCGTATCCCTACACCCAGTTCACGACACGTAACCTG
CTAGTCGAGGAGTACGCCCACGGCATCCCGCTCGCCGACTTCTTGGAAAACGGCGGCGGCGTGTTCCAGCACGAC
ATCGCCGACGAGGGCCTCGACGCCTTTCTGCACATGCTGCTCATCGACAACTTCGTCCACGCAGACCTCCATCCG
GGCAACATCATGGTCCGCTTTTATCAGACGGCCCGACCCGAGTTGCGTCTCCGTAGGTCCCGCGACAAGCCTCTT
CCCGCCAGCGACGAAGACGAGGCGGCCGACGTAACGGAGCGCGTGCTCGAGCGTCTGCGACCCTTTCGCCATCGC
AAGAACCAGGCTGCGTGGGAGGCCGAGCTAGCCAGCATCGACGCCGAGGGCTATCGGCCGCAGCTCGTCTTCATC
GACACGGGCCTCGTGACGGAGCTGAGCGAGACGAACCGGGCCAACTTTCTGGCCCTGTTCCGGGCCGTGGCCGAG
TTCGACGGTTACAAAGCCGGACACCTCATGTGCGAGCGCTGCCGGCAGCCGGACGCCGTGCTGGAGCAGGAGATT
TTCGCCCTCAAGATGCAGCATCTGGTATTGGGCGTCAAGCGTCGTACGCTCGCCCTCGGCGCCGTCAAGATCGGA
GACATCCTACAGCGTGTGCTGGCCATGGTTCGCCATCACCACGTCCGTCTCGAGGGCGACTTCGTCAACGTCGTT
CTCAGCATCTTGTTGCTCGAGGGAATCGGCCGTAGTCTGAGTCCGGACGTCGACCTCCTCAGCAGCTCGTTGCCC
ATTCTTCGTCAGCTGAGCGCCCAGAGCGGTGCAGAGATGGCCAAGCAGGGCGATTTTTCCATGTTGGTCGTCTGG
ATGGGCCTTGAGACGAGAAAGTTTCTTCAAGCCAGCGTCGAGGACGTTGAACGCTGTGTCAAGTCTGATCTCTTG
TCACCCAACGTATAG
Gene >Ophio5|2490
ATGATTAGGGGCTTCGTCTTGCGCCGGCTCTTCACCCGCCCGACTCTCGGCTCCGGAGGAATCCGACTCTCGGCC
CCATGGCGACAGACGAGACGGCCGATGGCCAGATCGGCGCTCCGGGCGTCTGCCGGCATCGCCGCTGCCGGAATG
GCAACGTTTGTTGAGCTCGCGAACCGCGACAATAGCGGCACCGACGAGACGGGCGAGCACCGCATGCTGGAGTTG
TCGCGGGCCGAGATGAACAAGACGGTGTCGGACGACGATCGGGGCTTGGTCCGCTTCGTGCGTGAGGCTGTACTG
CTATTCGATGTCTGGATCTGGGAGCCCATCTGTACGGGCGCCCGTTTCCTACAGCTGGTCATCATCTTCGTCCCC
GTCCTGGCCGCCGTGCCCGCCCTCTGGCTTGGACGTCGGCAACGGCATCGCGACGATGAGAGGAGCGGCACCCTC
TGGTGGTACGGACTCCTCGTCCAATCCATGGAATGGGCCGGCCCGGCCTTTATCAAACTCGGTCAGTGGGCAGCC
TCGCGGTCCGATCTCCTCCCGACGGAGATGTGTGAGATGATGTCGAGGCTGCACTCGCACGCGCCCGCCCACTCG
ATGCGCCAGACTCGCGAGACGGTGAGCGCCGCCTTTGACGGCCGCTCCCTGGAAGACGTCTTCGACGAATTCGAC
GAGACGCCCCTCGGCGTCGGCGCCATCGCCCAAGTCTATCGAGCGAGGCTGAAGCCCGATCTCATGGCCCCGGCC
GACGCCGACGTGGCGACGCCGCATCCGCCAGCCTTGTCGGACAACGTACGGCGGCATGTCGACTCGGTGCTCAAG
AGGTCGCCTCAGCGCGTTCCTTCGAGCTTCGTCGCCGTCAAGGTGCTGCACCCAAACGTCGAGCGCACCGTCCGA
AGGGACTTGACCATCATGGGCTTCTTCGCTTCCATCCTCAACGCCATCCCTACCATAGAGTGGCTCTCGCTCCCT
GACGAGGTGGCTCAGTTCGGCGCCATGATGCGTCTGCAGCTCGACCTGCGGATCGAAGCCGCCAATCTCGAAACG
TTCCGCCAGAACTTCAAGCACCGCTCAACCGCCTGGTTCCCGTATCCCTACACCCAGTTCACGACACGTAACCTG
CTAGTCGAGGAGTACGCCCACGGCATCCCGCTCGCCGACTTCTTGGAAAACGGCGGCGGCGTGTTCCAGCACGAC
ATCGCCGACGAGGGCCTCGACGCCTTTCTGCACATGCTGCTCATCGACAACTTCGTCCACGCAGACCTCCATCCG
GGCAACATCATGGTCCGCTTTTATCAGACGGCCCGACCCGAGTTGCGTCTCCGTAGGTCCCGCGACAAGCCTCTT
CCCGCCAGCGACGAAGACGAGGCGGCCGACGTAACGGAGCGCGTGCTCGAGCGTCTGCGACCCTTTCGCCATCGC
AAGAACCAGGCTGCGTGGGAGGCCGAGCTAGCCAGCATCGACGCCGAGGGCTATCGGCCGCAGCTCGTCTTCATC
GACACGGGCCTCGTGACGGAGCTGAGCGAGACGAACCGGGCCAACTTTCTGGCCCTGTTCCGGGCCGTGGCCGAG
TTCGACGGTTACAAAGCCGGACACCTCATGTGCGAGCGCTGCCGGCAGCCGGACGCCGTGCTGGAGCAGGAGATT
TTCGCCCTCAAGATGCAGCATCTGGTATTGGGCGTCAAGCGTCGTACGCTCGCCCTCGGCGCCGTCAAGATCGGA
GACATCCTACAGCGTGTGCTGGCCATGGTTCGCCATCACCACGTCCGTCTCGAGGGCGACTTCGTCAACGTCGTT
CTCAGCATCTTGTTGCTCGAGGGAATCGGCCGTAGTCTGAGTCCGGACGTCGACCTCCTCAGCAGCTCGTTGCCC
ATTCTTCGTCAGCTGAGCGCCCAGAGCGGTGCAGAGATGGCCAAGCAGGGCGATTTTTCCATGTTGGTCGTCTGG
ATGGGCCTTGAGACGAGAAAGTTTCTTCAAGCCAGCGTCGAGGACGTGAGTCGGTTTTTTTTTTTTTCCTTTTCT
TTTTTCTCCCTTCTTGACTTTCGCTCTTTTGGGAATCACCGTTCTTTTGAACCCGTCCTATCCTCGCTGCTGACT
GACGACATCCATCTGCCCAGGTTGAACGCTGTGTCAAGTCTGATCTCTTGTCACCCAACGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail