Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2490
Gene name
Locationscaffold_206:622..2787
Strand-
Gene length (bp)2165
Transcript length (bp)2040
Coding sequence length (bp)2037
Protein length (aa) 679

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03109 ABC1 ABC1 atypical kinase-like domain 1.5E-09 191 243
PF03109 ABC1 ABC1 atypical kinase-like domain 2.3E-32 285 431

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02981|YP109_YEAST ABC1 family protein YPL109C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL109C PE=1 SV=2 63 678 6.0E-161
sp|Q9P7M0|YOS3_SCHPO ABC1 family protein C21C3.03, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.03 PE=3 SV=2 115 679 2.0E-149
sp|Q55G83|ABKC_DICDI Probable serine/threonine-protein kinase abkC OS=Dictyostelium discoideum GN=abkC PE=3 SV=1 113 640 3.0E-84
sp|Q6NSR3|ADCK2_MOUSE Uncharacterized aarF domain-containing protein kinase 2 OS=Mus musculus GN=Adck2 PE=2 SV=1 113 627 1.0E-67
sp|Q7Z695|ADCK2_HUMAN Uncharacterized aarF domain-containing protein kinase 2 OS=Homo sapiens GN=ADCK2 PE=2 SV=1 149 627 2.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02981|YP109_YEAST ABC1 family protein YPL109C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL109C PE=1 SV=2 63 678 6.0E-161
sp|Q9P7M0|YOS3_SCHPO ABC1 family protein C21C3.03, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.03 PE=3 SV=2 115 679 2.0E-149
sp|Q55G83|ABKC_DICDI Probable serine/threonine-protein kinase abkC OS=Dictyostelium discoideum GN=abkC PE=3 SV=1 113 640 3.0E-84
sp|Q6NSR3|ADCK2_MOUSE Uncharacterized aarF domain-containing protein kinase 2 OS=Mus musculus GN=Adck2 PE=2 SV=1 113 627 1.0E-67
sp|Q7Z695|ADCK2_HUMAN Uncharacterized aarF domain-containing protein kinase 2 OS=Homo sapiens GN=ADCK2 PE=2 SV=1 149 627 2.0E-61
sp|A0L1M6|UBIB_SHESA Probable protein kinase UbiB OS=Shewanella sp. (strain ANA-3) GN=ubiB PE=3 SV=1 159 633 1.0E-33
sp|Q0HZP9|UBIB_SHESR Probable protein kinase UbiB OS=Shewanella sp. (strain MR-7) GN=ubiB PE=3 SV=1 159 633 1.0E-33
sp|Q0HE99|UBIB_SHESM Probable protein kinase UbiB OS=Shewanella sp. (strain MR-4) GN=ubiB PE=3 SV=1 159 633 3.0E-33
sp|Q9CKD4|UBIB_PASMU Probable protein kinase UbiB OS=Pasteurella multocida (strain Pm70) GN=ubiB PE=3 SV=1 133 650 4.0E-33
sp|A1RP80|UBIB_SHESW Probable protein kinase UbiB OS=Shewanella sp. (strain W3-18-1) GN=ubiB PE=3 SV=1 159 633 1.0E-32
sp|A4Y2Q3|UBIB_SHEPC Probable protein kinase UbiB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiB PE=3 SV=1 159 633 1.0E-32
sp|Q8E9R5|UBIB_SHEON Probable protein kinase UbiB OS=Shewanella oneidensis (strain MR-1) GN=ubiB PE=3 SV=1 126 634 2.0E-32
sp|A1U669|UBIB_MARHV Probable protein kinase UbiB OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ubiB PE=3 SV=1 159 627 1.0E-31
sp|A9KYL6|UBIB_SHEB9 Probable protein kinase UbiB OS=Shewanella baltica (strain OS195) GN=ubiB PE=3 SV=1 159 632 1.0E-31
sp|A6WIE7|UBIB_SHEB8 Probable protein kinase UbiB OS=Shewanella baltica (strain OS185) GN=ubiB PE=3 SV=1 159 632 1.0E-31
sp|B1KR05|UBIB_SHEWM Probable protein kinase UbiB OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiB PE=3 SV=1 133 635 2.0E-31
sp|Q0I208|UBIB_HAES1 Probable protein kinase UbiB OS=Haemophilus somnus (strain 129Pt) GN=ubiB PE=3 SV=1 133 639 3.0E-31
sp|A3D9F4|UBIB_SHEB5 Probable protein kinase UbiB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiB PE=3 SV=1 159 632 6.0E-31
sp|B8E6B4|UBIB_SHEB2 Probable protein kinase UbiB OS=Shewanella baltica (strain OS223) GN=ubiB PE=3 SV=1 159 632 6.0E-31
sp|Q088I0|UBIB_SHEFN Probable protein kinase UbiB OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiB PE=3 SV=1 159 637 2.0E-30
sp|A1SAK0|UBIB_SHEAM Probable protein kinase UbiB OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiB PE=3 SV=1 138 635 4.0E-30
sp|Q9JVQ5|UBIB_NEIMA Probable protein kinase UbiB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ubiB PE=3 SV=1 159 430 4.0E-29
sp|Q9K0N0|UBIB_NEIMB Probable protein kinase UbiB OS=Neisseria meningitidis serogroup B (strain MC58) GN=ubiB PE=3 SV=1 159 430 6.0E-29
sp|Q12S25|UBIB_SHEDO Probable protein kinase UbiB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiB PE=3 SV=1 138 634 6.0E-29
sp|A0KEF8|UBIB_AERHH Probable protein kinase UbiB OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ubiB PE=3 SV=1 159 438 9.0E-29
sp|B8CI04|UBIB_SHEPW Probable protein kinase UbiB OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ubiB PE=3 SV=1 133 642 5.0E-28
sp|C4L962|UBIB_TOLAT Probable protein kinase UbiB OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ubiB PE=3 SV=1 156 439 1.0E-27
sp|A8H968|UBIB_SHEPA Probable protein kinase UbiB OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiB PE=3 SV=1 159 634 5.0E-27
sp|A4STK9|UBIB_AERS4 Probable protein kinase UbiB OS=Aeromonas salmonicida (strain A449) GN=ubiB PE=3 SV=1 159 438 5.0E-27
sp|O07443|UBIB_PROST Probable protein kinase UbiB OS=Providencia stuartii GN=ubiB PE=1 SV=1 164 672 5.0E-27
sp|A3QIE3|UBIB_SHELP Probable protein kinase UbiB OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ubiB PE=3 SV=1 159 634 1.0E-26
sp|Q3BZ34|UBIB_XANC5 Probable protein kinase UbiB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiB PE=3 SV=1 164 630 2.0E-26
sp|B8F6K1|UBIB_HAEPS Probable protein kinase UbiB OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=ubiB PE=3 SV=1 164 439 2.0E-26
sp|Q6DAQ5|UBIB_PECAS Probable protein kinase UbiB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ubiB PE=3 SV=1 159 635 3.0E-26
sp|Q7VN62|UBIB_HAEDU Probable protein kinase UbiB OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiB PE=3 SV=1 159 635 3.0E-26
sp|B0TJ18|UBIB_SHEHH Probable protein kinase UbiB OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiB PE=3 SV=1 159 634 4.0E-26
sp|Q8PQT0|UBIB_XANAC Probable protein kinase UbiB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiB PE=3 SV=1 164 630 5.0E-26
sp|B7LTZ9|UBIB_ESCF3 Probable protein kinase UbiB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ubiB PE=3 SV=1 164 673 7.0E-26
sp|A6VDI8|UBIB_PSEA7 Probable protein kinase UbiB OS=Pseudomonas aeruginosa (strain PA7) GN=ubiB PE=3 SV=1 128 627 8.0E-26
sp|Q8PDW1|UBIB_XANCP Probable protein kinase UbiB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiB PE=3 SV=1 164 630 1.0E-25
sp|Q4V052|UBIB_XANC8 Probable protein kinase UbiB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiB PE=3 SV=1 164 630 1.0E-25
sp|B0RLZ0|UBIB_XANCB Probable protein kinase UbiB OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiB PE=3 SV=1 164 630 2.0E-25
sp|Q02EV2|UBIB_PSEAB Probable protein kinase UbiB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiB PE=3 SV=1 164 627 2.0E-25
sp|B7V3F8|UBIB_PSEA8 Probable protein kinase UbiB OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiB PE=3 SV=1 164 627 2.0E-25
sp|Q9HUB8|UBIB_PSEAE Probable protein kinase UbiB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiB PE=3 SV=1 164 627 2.0E-25
sp|Q5H616|UBIB_XANOR Probable protein kinase UbiB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiB PE=3 SV=1 164 630 2.0E-25
sp|B2ST34|UBIB_XANOP Probable protein kinase UbiB OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiB PE=3 SV=1 164 630 2.0E-25
sp|Q2P8Q0|UBIB_XANOM Probable protein kinase UbiB OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiB PE=3 SV=1 164 630 2.0E-25
sp|Q2SN14|UBIB_HAHCH Probable protein kinase UbiB OS=Hahella chejuensis (strain KCTC 2396) GN=ubiB PE=3 SV=1 156 636 2.0E-25
sp|C6DI75|UBIB_PECCP Probable protein kinase UbiB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ubiB PE=3 SV=1 159 627 3.0E-25
sp|Q6LVW8|UBIB_PHOPR Probable protein kinase UbiB OS=Photobacterium profundum GN=ubiB PE=3 SV=1 164 640 3.0E-25
sp|C1DHS4|UBIB_AZOVD Probable protein kinase UbiB OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiB PE=3 SV=1 164 627 3.0E-25
sp|P0A197|UBIB_SALTY Probable protein kinase UbiB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|P0A198|UBIB_SALTI Probable protein kinase UbiB OS=Salmonella typhi GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|B4TNY1|UBIB_SALSV Probable protein kinase UbiB OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|B5BIY1|UBIB_SALPK Probable protein kinase UbiB OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|C0Q3E3|UBIB_SALPC Probable protein kinase UbiB OS=Salmonella paratyphi C (strain RKS4594) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|A9MY99|UBIB_SALPB Probable protein kinase UbiB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|Q5PKP2|UBIB_SALPA Probable protein kinase UbiB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|B4SZ75|UBIB_SALNS Probable protein kinase UbiB OS=Salmonella newport (strain SL254) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|B4TBR5|UBIB_SALHS Probable protein kinase UbiB OS=Salmonella heidelberg (strain SL476) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|B5FNW8|UBIB_SALDC Probable protein kinase UbiB OS=Salmonella dublin (strain CT_02021853) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|Q57HN6|UBIB_SALCH Probable protein kinase UbiB OS=Salmonella choleraesuis (strain SC-B67) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|B5EZV0|UBIB_SALA4 Probable protein kinase UbiB OS=Salmonella agona (strain SL483) GN=ubiB PE=3 SV=1 164 668 3.0E-25
sp|A7MQL5|UBIB_CROS8 Probable protein kinase UbiB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiB PE=3 SV=1 139 627 4.0E-25
sp|B7VHC3|UBIB_VIBTL Probable protein kinase UbiB OS=Vibrio tasmaniensis (strain LGP32) GN=ubiB PE=3 SV=1 125 627 6.0E-25
sp|A8ACY4|UBIB_CITK8 Probable protein kinase UbiB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiB PE=3 SV=1 164 673 7.0E-25
sp|B5QW75|UBIB_SALEP Probable protein kinase UbiB OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiB PE=3 SV=1 164 668 8.0E-25
sp|B5RFM6|UBIB_SALG2 Probable protein kinase UbiB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiB PE=3 SV=1 164 668 8.0E-25
sp|Q7MZ83|UBIB_PHOLL Probable protein kinase UbiB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiB PE=3 SV=1 164 635 9.0E-25
sp|Q7NZD1|UBIB_CHRVO Probable protein kinase UbiB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiB PE=3 SV=1 159 430 1.0E-24
sp|C5CWY2|UBIB_VARPS Probable protein kinase UbiB OS=Variovorax paradoxus (strain S110) GN=ubiB PE=3 SV=1 156 430 1.0E-24
sp|A7MTX4|UBIB_VIBCB Probable protein kinase UbiB OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiB PE=3 SV=1 164 629 2.0E-24
sp|B1LM23|UBIB_ECOSM Probable protein kinase UbiB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|A3N3S2|UBIB_ACTP2 Probable protein kinase UbiB OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiB PE=3 SV=1 159 439 2.0E-24
sp|Q4KJL4|UBIB_PSEF5 Probable protein kinase UbiB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ubiB PE=3 SV=1 164 627 2.0E-24
sp|A4WFY3|UBIB_ENT38 Probable protein kinase UbiB OS=Enterobacter sp. (strain 638) GN=ubiB PE=3 SV=1 164 627 2.0E-24
sp|Q3YVD0|UBIB_SHISS Probable protein kinase UbiB OS=Shigella sonnei (strain Ss046) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|Q1R475|UBIB_ECOUT Probable protein kinase UbiB OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|Q8FBI8|UBIB_ECOL6 Probable protein kinase UbiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|Q0TAL9|UBIB_ECOL5 Probable protein kinase UbiB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|A1AI24|UBIB_ECOK1 Probable protein kinase UbiB OS=Escherichia coli O1:K1 / APEC GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|B7N2E3|UBIB_ECO81 Probable protein kinase UbiB OS=Escherichia coli O81 (strain ED1a) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|B7MHC2|UBIB_ECO45 Probable protein kinase UbiB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|B7NFD8|UBIB_ECOLU Probable protein kinase UbiB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|B7NV31|UBIB_ECO7I Probable protein kinase UbiB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|B7UNG5|UBIB_ECO27 Probable protein kinase UbiB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiB PE=3 SV=1 164 673 2.0E-24
sp|C3LPS7|UBIB_VIBCM Probable protein kinase UbiB OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiB PE=3 SV=1 125 637 2.0E-24
sp|Q9KVQ4|UBIB_VIBCH Probable protein kinase UbiB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiB PE=3 SV=1 125 637 2.0E-24
sp|P0A6A2|UBIB_SHIFL Probable protein kinase UbiB OS=Shigella flexneri GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|Q0SZ27|UBIB_SHIF8 Probable protein kinase UbiB OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|Q32A13|UBIB_SHIDS Probable protein kinase UbiB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|Q31UF1|UBIB_SHIBS Probable protein kinase UbiB OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|B2TVI6|UBIB_SHIB3 Probable protein kinase UbiB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|B6I4H7|UBIB_ECOSE Probable protein kinase UbiB OS=Escherichia coli (strain SE11) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|P0A6A0|UBIB_ECOLI Probable protein kinase UbiB OS=Escherichia coli (strain K12) GN=ubiB PE=1 SV=1 164 673 3.0E-24
sp|B1IW70|UBIB_ECOLC Probable protein kinase UbiB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|A8A6U2|UBIB_ECOHS Probable protein kinase UbiB OS=Escherichia coli O9:H4 (strain HS) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|B1XAJ9|UBIB_ECODH Probable protein kinase UbiB OS=Escherichia coli (strain K12 / DH10B) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|C5A011|UBIB_ECOBW Probable protein kinase UbiB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|B7M640|UBIB_ECO8A Probable protein kinase UbiB OS=Escherichia coli O8 (strain IAI1) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|B5YY84|UBIB_ECO5E Probable protein kinase UbiB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|P0A6A1|UBIB_ECO57 Probable protein kinase UbiB OS=Escherichia coli O157:H7 GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|B7L998|UBIB_ECO55 Probable protein kinase UbiB OS=Escherichia coli (strain 55989 / EAEC) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|A7ZU42|UBIB_ECO24 Probable protein kinase UbiB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiB PE=3 SV=1 164 673 3.0E-24
sp|A4XPM5|UBIB_PSEMY Probable protein kinase UbiB OS=Pseudomonas mendocina (strain ymp) GN=ubiB PE=3 SV=1 159 627 3.0E-24
sp|A5F4G3|UBIB_VIBC3 Probable protein kinase UbiB OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiB PE=3 SV=1 125 637 4.0E-24
sp|B2VG47|UBIB_ERWT9 Probable protein kinase UbiB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiB PE=3 SV=1 159 627 5.0E-24
sp|B0BU10|UBIB_ACTPJ Probable protein kinase UbiB OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ubiB PE=3 SV=1 159 439 7.0E-24
sp|Q87CN1|UBIB_XYLFT Probable protein kinase UbiB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ubiB PE=3 SV=1 159 630 1.0E-23
sp|B2I583|UBIB_XYLF2 Probable protein kinase UbiB OS=Xylella fastidiosa (strain M23) GN=ubiB PE=3 SV=1 159 630 1.0E-23
sp|B0U2R2|UBIB_XYLFM Probable protein kinase UbiB OS=Xylella fastidiosa (strain M12) GN=ubiB PE=3 SV=1 164 630 1.0E-23
sp|Q87TH2|UBIB_VIBPA Probable protein kinase UbiB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiB PE=3 SV=1 164 629 1.0E-23
sp|Q3KJC7|UBIB_PSEPF Probable protein kinase UbiB OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiB PE=3 SV=1 164 627 2.0E-23
sp|Q55884|Y095_SYNY3 Uncharacterized protein sll0095 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0095 PE=3 SV=1 156 430 2.0E-23
sp|Q9PCE8|UBIB_XYLFA Probable protein kinase UbiB OS=Xylella fastidiosa (strain 9a5c) GN=ubiB PE=3 SV=1 159 630 2.0E-23
sp|B0KM38|UBIB_PSEPG Probable protein kinase UbiB OS=Pseudomonas putida (strain GB-1) GN=ubiB PE=3 SV=1 164 627 2.0E-23
sp|Q48PJ6|UBIB_PSE14 Probable protein kinase UbiB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiB PE=3 SV=1 164 627 3.0E-23
sp|Q1I3S8|UBIB_PSEE4 Probable protein kinase UbiB OS=Pseudomonas entomophila (strain L48) GN=ubiB PE=3 SV=1 164 627 3.0E-23
sp|C3K8U2|UBIB_PSEFS Probable protein kinase UbiB OS=Pseudomonas fluorescens (strain SBW25) GN=ubiB PE=3 SV=1 164 627 4.0E-23
sp|Q8Y275|UBIB_RALSO Probable protein kinase UbiB OS=Ralstonia solanacearum (strain GMI1000) GN=ubiB PE=3 SV=1 126 430 4.0E-23
sp|Q7MQ31|UBIB_VIBVY Probable protein kinase UbiB OS=Vibrio vulnificus (strain YJ016) GN=ubiB PE=3 SV=1 164 629 4.0E-23
sp|Q87UZ0|UBIB_PSESM Probable protein kinase UbiB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiB PE=3 SV=1 164 627 6.0E-23
sp|B1J2S6|UBIB_PSEPW Probable protein kinase UbiB OS=Pseudomonas putida (strain W619) GN=ubiB PE=3 SV=1 164 644 7.0E-23
sp|A9BP42|UBIB_DELAS Probable protein kinase UbiB OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=ubiB PE=3 SV=1 156 430 1.0E-22
sp|B3GZD0|UBIB_ACTP7 Probable protein kinase UbiB OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ubiB PE=3 SV=1 159 439 2.0E-22
sp|Q8DDQ1|UBIB_VIBVU Probable protein kinase UbiB OS=Vibrio vulnificus (strain CMCP6) GN=ubiB PE=3 SV=1 164 629 2.0E-22
sp|B6EHA6|UBIB_ALISL Probable protein kinase UbiB OS=Aliivibrio salmonicida (strain LFI1238) GN=ubiB PE=3 SV=1 164 634 2.0E-22
sp|A5WA47|UBIB_PSEP1 Probable protein kinase UbiB OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiB PE=3 SV=1 164 627 2.0E-22
sp|Q4ZZG5|UBIB_PSEU2 Probable protein kinase UbiB OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiB PE=3 SV=1 164 627 3.0E-22
sp|A8G8C0|UBIB_SERP5 Probable protein kinase UbiB OS=Serratia proteamaculans (strain 568) GN=ubiB PE=3 SV=1 164 627 3.0E-22
sp|Q491V8|UBIB_BLOPB Probable protein kinase UbiB OS=Blochmannia pennsylvanicus (strain BPEN) GN=ubiB PE=3 SV=1 88 439 5.0E-22
sp|Q66FS8|UBIB_YERPS Probable protein kinase UbiB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|A4TR37|UBIB_YERPP Probable protein kinase UbiB OS=Yersinia pestis (strain Pestoides F) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|Q1CNB2|UBIB_YERPN Probable protein kinase UbiB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|A9R429|UBIB_YERPG Probable protein kinase UbiB OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|Q8ZAM1|UBIB_YERPE Probable protein kinase UbiB OS=Yersinia pestis GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|B2K0Y6|UBIB_YERPB Probable protein kinase UbiB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|Q1CBF8|UBIB_YERPA Probable protein kinase UbiB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|A7FDE2|UBIB_YERP3 Probable protein kinase UbiB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiB PE=3 SV=1 133 666 5.0E-22
sp|A6TGL5|UBIB_KLEP7 Probable protein kinase UbiB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ubiB PE=3 SV=1 164 627 6.0E-22
sp|B1XWR5|UBIB_LEPCP Probable protein kinase UbiB OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ubiB PE=3 SV=1 156 430 6.0E-22
sp|Q63X97|UBIB_BURPS Probable protein kinase UbiB OS=Burkholderia pseudomallei (strain K96243) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|A3N5V1|UBIB_BURP6 Probable protein kinase UbiB OS=Burkholderia pseudomallei (strain 668) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|Q3JVZ2|UBIB_BURP1 Probable protein kinase UbiB OS=Burkholderia pseudomallei (strain 1710b) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|A3NRJ7|UBIB_BURP0 Probable protein kinase UbiB OS=Burkholderia pseudomallei (strain 1106a) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|A1V750|UBIB_BURMS Probable protein kinase UbiB OS=Burkholderia mallei (strain SAVP1) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|Q62MP2|UBIB_BURMA Probable protein kinase UbiB OS=Burkholderia mallei (strain ATCC 23344) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|A2S8L4|UBIB_BURM9 Probable protein kinase UbiB OS=Burkholderia mallei (strain NCTC 10229) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|A3MNU1|UBIB_BURM7 Probable protein kinase UbiB OS=Burkholderia mallei (strain NCTC 10247) GN=ubiB PE=3 SV=1 156 430 2.0E-21
sp|Q2NWT9|UBIB_SODGM Probable protein kinase UbiB OS=Sodalis glossinidius (strain morsitans) GN=ubiB PE=3 SV=1 164 664 2.0E-21
sp|B5XYH9|UBIB_KLEP3 Probable protein kinase UbiB OS=Klebsiella pneumoniae (strain 342) GN=ubiB PE=3 SV=1 164 627 2.0E-21
sp|B2SX38|UBIB_BURPP Probable protein kinase UbiB OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ubiB PE=3 SV=1 159 430 3.0E-21
sp|A1JIF4|UBIB_YERE8 Probable protein kinase UbiB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiB PE=3 SV=1 159 627 8.0E-21
sp|B5FF80|UBIB_VIBFM Probable protein kinase UbiB OS=Vibrio fischeri (strain MJ11) GN=ubiB PE=3 SV=1 164 634 9.0E-21
sp|P73627|Y1770_SYNY3 Uncharacterized protein sll1770 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1770 PE=3 SV=1 164 430 1.0E-20
sp|Q145N7|UBIB_BURXL Probable protein kinase UbiB OS=Burkholderia xenovorans (strain LB400) GN=ubiB PE=3 SV=1 159 430 2.0E-20
sp|Q9D0L4|ADCK1_MOUSE Uncharacterized aarF domain-containing protein kinase 1 OS=Mus musculus GN=Adck1 PE=1 SV=1 166 431 2.0E-20
sp|Q86TW2|ADCK1_HUMAN Uncharacterized aarF domain-containing protein kinase 1 OS=Homo sapiens GN=ADCK1 PE=2 SV=2 166 431 2.0E-20
sp|B3PH50|UBIB_CELJU Probable protein kinase UbiB OS=Cellvibrio japonicus (strain Ueda107) GN=ubiB PE=3 SV=1 164 439 2.0E-20
sp|Q5E8V3|UBIB_VIBF1 Probable protein kinase UbiB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ubiB PE=3 SV=1 164 634 2.0E-20
sp|B2JCV1|UBIB_BURP8 Probable protein kinase UbiB OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ubiB PE=3 SV=1 159 430 4.0E-20
sp|Q5ZMT7|ADCK1_CHICK Uncharacterized aarF domain-containing protein kinase 1 OS=Gallus gallus GN=ADCK1 PE=2 SV=1 166 431 6.0E-20
sp|Q6INL7|ADCK1_XENLA Uncharacterized aarF domain-containing protein kinase 1 OS=Xenopus laevis GN=adck1 PE=2 SV=1 166 431 6.0E-20
sp|B9ME24|UBIB_ACIET Probable protein kinase UbiB OS=Acidovorax ebreus (strain TPSY) GN=ubiB PE=3 SV=1 156 430 2.0E-19
sp|A1W4D7|UBIB_ACISJ Probable protein kinase UbiB OS=Acidovorax sp. (strain JS42) GN=ubiB PE=3 SV=1 156 430 2.0E-19
sp|C5BCA6|UBIB_EDWI9 Probable protein kinase UbiB OS=Edwardsiella ictaluri (strain 93-146) GN=ubiB PE=3 SV=1 123 439 1.0E-18
sp|A1TTA2|UBIB_ACIAC Probable protein kinase UbiB OS=Acidovorax citrulli (strain AAC00-1) GN=ubiB PE=3 SV=1 156 430 1.0E-17
sp|Q5M7P6|ADCK1_XENTR Uncharacterized aarF domain-containing protein kinase 1 OS=Xenopus tropicalis GN=adck1 PE=2 SV=1 166 442 2.0E-17
sp|Q8RWG1|Y4139_ARATH Uncharacterized aarF domain-containing protein kinase At4g31390, chloroplastic OS=Arabidopsis thaliana GN=At4g31390 PE=2 SV=1 164 429 4.0E-17
sp|Q9MA15|Y1796_ARATH Uncharacterized aarF domain-containing protein kinase At1g79600, chloroplastic OS=Arabidopsis thaliana GN=At1g79600 PE=2 SV=1 164 429 5.0E-17
sp|P73577|Y889_SYNY3 Uncharacterized protein slr0889 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0889 PE=3 SV=1 164 429 4.0E-16
sp|Q46189|YHG1_CLOPA Uncharacterized protein in hydrogenase 1 5'region (Fragment) OS=Clostridium pasteurianum PE=3 SV=1 158 431 3.0E-15
sp|O60111|MCP2L_SCHPO ABC1 family protein MCP2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.02 PE=3 SV=2 157 431 5.0E-15
sp|Q54TR5|ABKB_DICDI Probable serine/threonine-protein kinase abkB OS=Dictyostelium discoideum GN=abkB PE=3 SV=1 167 442 6.0E-15
sp|Q06567|MCP2_YEAST ABC1 family protein MCP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCP2 PE=1 SV=1 164 437 4.0E-14
sp|Q54P00|ABKD_DICDI Probable serine/threonine-protein kinase abkD OS=Dictyostelium discoideum GN=abkD PE=2 SV=1 164 431 1.0E-13
sp|Q55680|Y005_SYNY3 Uncharacterized protein sll0005 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0005 PE=3 SV=1 118 429 2.0E-13
sp|P73121|Y1919_SYNY3 Uncharacterized protein slr1919 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1919 PE=3 SV=1 164 429 6.0E-13
sp|O42653|YF9E_SCHPO ABC1 family protein C10F6.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.14c PE=3 SV=1 156 431 7.0E-11
sp|O04212|Y2090_ARATH Putative ABC1 protein At2g40090 OS=Arabidopsis thaliana GN=At2g40090 PE=2 SV=2 164 528 2.0E-10
sp|P9WQI1|Y647_MYCTU Uncharacterized protein Rv0647c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0647c PE=1 SV=1 156 430 1.0E-06
sp|P9WQI0|Y647_MYCTO Uncharacterized protein MT0675 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0675 PE=3 SV=1 156 430 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 38 57 19
2 114 136 22
3 303 325 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2490
MIRGFVLRRLFTRPTLGSGGIRLSAPWRQTRRPMARSALRASAGIAAAGMATFVELANRDNSGTDETGEHRMLEL
SRAEMNKTVSDDDRGLVRFVREAVLLFDVWIWEPICTGARFLQLVIIFVPVLAAVPALWLGRRQRHRDDERSGTL
WWYGLLVQSMEWAGPAFIKLGQWAASRSDLLPTEMCEMMSRLHSHAPAHSMRQTRETVSAAFDGRSLEDVFDEFD
ETPLGVGAIAQVYRARLKPDLMAPADADVATPHPPALSDNVRRHVDSVLKRSPQRVPSSFVAVKVLHPNVERTVR
RDLTIMGFFASILNAIPTIEWLSLPDEVAQFGAMMRLQLDLRIEAANLETFRQNFKHRSTAWFPYPYTQFTTRNL
LVEEYAHGIPLADFLENGGGVFQHDIADEGLDAFLHMLLIDNFVHADLHPGNIMVRFYQTARPELRLRRSRDKPL
PASDEDEAADVTERVLERLRPFRHRKNQAAWEAELASIDAEGYRPQLVFIDTGLVTELSETNRANFLALFRAVAE
FDGYKAGHLMCERCRQPDAVLEQEIFALKMQHLVLGVKRRTLALGAVKIGDILQRVLAMVRHHHVRLEGDFVNVV
LSILLLEGIGRSLSPDVDLLSSSLPILRQLSAQSGAEMAKQGDFSMLVVWMGLETRKFLQASVEDVERCVKSDLL
SPNV
Coding >Ophio5|2490
ATGATTAGGGGCTTCGTCTTGCGCCGGCTCTTCACCCGCCCGACTCTCGGCTCCGGAGGAATCCGACTCTCGGCC
CCATGGCGACAGACGAGACGGCCGATGGCCAGATCGGCGCTCCGGGCGTCTGCCGGCATCGCCGCTGCCGGAATG
GCAACGTTTGTTGAGCTCGCGAACCGCGACAATAGCGGCACCGACGAGACGGGCGAGCACCGCATGCTGGAGTTG
TCGCGGGCCGAGATGAACAAGACGGTGTCGGACGACGATCGGGGCTTGGTCCGCTTCGTGCGTGAGGCTGTACTG
CTATTCGATGTCTGGATCTGGGAGCCCATCTGTACGGGCGCCCGTTTCCTACAGCTGGTCATCATCTTCGTCCCC
GTCCTGGCCGCCGTGCCCGCCCTCTGGCTTGGACGTCGGCAACGGCATCGCGACGATGAGAGGAGCGGCACCCTC
TGGTGGTACGGACTCCTCGTCCAATCCATGGAATGGGCCGGCCCGGCCTTTATCAAACTCGGTCAGTGGGCAGCC
TCGCGGTCCGATCTCCTCCCGACGGAGATGTGTGAGATGATGTCGAGGCTGCACTCGCACGCGCCCGCCCACTCG
ATGCGCCAGACTCGCGAGACGGTGAGCGCCGCCTTTGACGGCCGCTCCCTGGAAGACGTCTTCGACGAATTCGAC
GAGACGCCCCTCGGCGTCGGCGCCATCGCCCAAGTCTATCGAGCGAGGCTGAAGCCCGATCTCATGGCCCCGGCC
GACGCCGACGTGGCGACGCCGCATCCGCCAGCCTTGTCGGACAACGTACGGCGGCATGTCGACTCGGTGCTCAAG
AGGTCGCCTCAGCGCGTTCCTTCGAGCTTCGTCGCCGTCAAGGTGCTGCACCCAAACGTCGAGCGCACCGTCCGA
AGGGACTTGACCATCATGGGCTTCTTCGCTTCCATCCTCAACGCCATCCCTACCATAGAGTGGCTCTCGCTCCCT
GACGAGGTGGCTCAGTTCGGCGCCATGATGCGTCTGCAGCTCGACCTGCGGATCGAAGCCGCCAATCTCGAAACG
TTCCGCCAGAACTTCAAGCACCGCTCAACCGCCTGGTTCCCGTATCCCTACACCCAGTTCACGACACGTAACCTG
CTAGTCGAGGAGTACGCCCACGGCATCCCGCTCGCCGACTTCTTGGAAAACGGCGGCGGCGTGTTCCAGCACGAC
ATCGCCGACGAGGGCCTCGACGCCTTTCTGCACATGCTGCTCATCGACAACTTCGTCCACGCAGACCTCCATCCG
GGCAACATCATGGTCCGCTTTTATCAGACGGCCCGACCCGAGTTGCGTCTCCGTAGGTCCCGCGACAAGCCTCTT
CCCGCCAGCGACGAAGACGAGGCGGCCGACGTAACGGAGCGCGTGCTCGAGCGTCTGCGACCCTTTCGCCATCGC
AAGAACCAGGCTGCGTGGGAGGCCGAGCTAGCCAGCATCGACGCCGAGGGCTATCGGCCGCAGCTCGTCTTCATC
GACACGGGCCTCGTGACGGAGCTGAGCGAGACGAACCGGGCCAACTTTCTGGCCCTGTTCCGGGCCGTGGCCGAG
TTCGACGGTTACAAAGCCGGACACCTCATGTGCGAGCGCTGCCGGCAGCCGGACGCCGTGCTGGAGCAGGAGATT
TTCGCCCTCAAGATGCAGCATCTGGTATTGGGCGTCAAGCGTCGTACGCTCGCCCTCGGCGCCGTCAAGATCGGA
GACATCCTACAGCGTGTGCTGGCCATGGTTCGCCATCACCACGTCCGTCTCGAGGGCGACTTCGTCAACGTCGTT
CTCAGCATCTTGTTGCTCGAGGGAATCGGCCGTAGTCTGAGTCCGGACGTCGACCTCCTCAGCAGCTCGTTGCCC
ATTCTTCGTCAGCTGAGCGCCCAGAGCGGTGCAGAGATGGCCAAGCAGGGCGATTTTTCCATGTTGGTCGTCTGG
ATGGGCCTTGAGACGAGAAAGTTTCTTCAAGCCAGCGTCGAGGACGTTGAACGCTGTGTCAAGTCTGATCTCTTG
TCACCCAACGTA
Transcript >Ophio5|2490
ATGATTAGGGGCTTCGTCTTGCGCCGGCTCTTCACCCGCCCGACTCTCGGCTCCGGAGGAATCCGACTCTCGGCC
CCATGGCGACAGACGAGACGGCCGATGGCCAGATCGGCGCTCCGGGCGTCTGCCGGCATCGCCGCTGCCGGAATG
GCAACGTTTGTTGAGCTCGCGAACCGCGACAATAGCGGCACCGACGAGACGGGCGAGCACCGCATGCTGGAGTTG
TCGCGGGCCGAGATGAACAAGACGGTGTCGGACGACGATCGGGGCTTGGTCCGCTTCGTGCGTGAGGCTGTACTG
CTATTCGATGTCTGGATCTGGGAGCCCATCTGTACGGGCGCCCGTTTCCTACAGCTGGTCATCATCTTCGTCCCC
GTCCTGGCCGCCGTGCCCGCCCTCTGGCTTGGACGTCGGCAACGGCATCGCGACGATGAGAGGAGCGGCACCCTC
TGGTGGTACGGACTCCTCGTCCAATCCATGGAATGGGCCGGCCCGGCCTTTATCAAACTCGGTCAGTGGGCAGCC
TCGCGGTCCGATCTCCTCCCGACGGAGATGTGTGAGATGATGTCGAGGCTGCACTCGCACGCGCCCGCCCACTCG
ATGCGCCAGACTCGCGAGACGGTGAGCGCCGCCTTTGACGGCCGCTCCCTGGAAGACGTCTTCGACGAATTCGAC
GAGACGCCCCTCGGCGTCGGCGCCATCGCCCAAGTCTATCGAGCGAGGCTGAAGCCCGATCTCATGGCCCCGGCC
GACGCCGACGTGGCGACGCCGCATCCGCCAGCCTTGTCGGACAACGTACGGCGGCATGTCGACTCGGTGCTCAAG
AGGTCGCCTCAGCGCGTTCCTTCGAGCTTCGTCGCCGTCAAGGTGCTGCACCCAAACGTCGAGCGCACCGTCCGA
AGGGACTTGACCATCATGGGCTTCTTCGCTTCCATCCTCAACGCCATCCCTACCATAGAGTGGCTCTCGCTCCCT
GACGAGGTGGCTCAGTTCGGCGCCATGATGCGTCTGCAGCTCGACCTGCGGATCGAAGCCGCCAATCTCGAAACG
TTCCGCCAGAACTTCAAGCACCGCTCAACCGCCTGGTTCCCGTATCCCTACACCCAGTTCACGACACGTAACCTG
CTAGTCGAGGAGTACGCCCACGGCATCCCGCTCGCCGACTTCTTGGAAAACGGCGGCGGCGTGTTCCAGCACGAC
ATCGCCGACGAGGGCCTCGACGCCTTTCTGCACATGCTGCTCATCGACAACTTCGTCCACGCAGACCTCCATCCG
GGCAACATCATGGTCCGCTTTTATCAGACGGCCCGACCCGAGTTGCGTCTCCGTAGGTCCCGCGACAAGCCTCTT
CCCGCCAGCGACGAAGACGAGGCGGCCGACGTAACGGAGCGCGTGCTCGAGCGTCTGCGACCCTTTCGCCATCGC
AAGAACCAGGCTGCGTGGGAGGCCGAGCTAGCCAGCATCGACGCCGAGGGCTATCGGCCGCAGCTCGTCTTCATC
GACACGGGCCTCGTGACGGAGCTGAGCGAGACGAACCGGGCCAACTTTCTGGCCCTGTTCCGGGCCGTGGCCGAG
TTCGACGGTTACAAAGCCGGACACCTCATGTGCGAGCGCTGCCGGCAGCCGGACGCCGTGCTGGAGCAGGAGATT
TTCGCCCTCAAGATGCAGCATCTGGTATTGGGCGTCAAGCGTCGTACGCTCGCCCTCGGCGCCGTCAAGATCGGA
GACATCCTACAGCGTGTGCTGGCCATGGTTCGCCATCACCACGTCCGTCTCGAGGGCGACTTCGTCAACGTCGTT
CTCAGCATCTTGTTGCTCGAGGGAATCGGCCGTAGTCTGAGTCCGGACGTCGACCTCCTCAGCAGCTCGTTGCCC
ATTCTTCGTCAGCTGAGCGCCCAGAGCGGTGCAGAGATGGCCAAGCAGGGCGATTTTTCCATGTTGGTCGTCTGG
ATGGGCCTTGAGACGAGAAAGTTTCTTCAAGCCAGCGTCGAGGACGTTGAACGCTGTGTCAAGTCTGATCTCTTG
TCACCCAACGTATAG
Gene >Ophio5|2490
ATGATTAGGGGCTTCGTCTTGCGCCGGCTCTTCACCCGCCCGACTCTCGGCTCCGGAGGAATCCGACTCTCGGCC
CCATGGCGACAGACGAGACGGCCGATGGCCAGATCGGCGCTCCGGGCGTCTGCCGGCATCGCCGCTGCCGGAATG
GCAACGTTTGTTGAGCTCGCGAACCGCGACAATAGCGGCACCGACGAGACGGGCGAGCACCGCATGCTGGAGTTG
TCGCGGGCCGAGATGAACAAGACGGTGTCGGACGACGATCGGGGCTTGGTCCGCTTCGTGCGTGAGGCTGTACTG
CTATTCGATGTCTGGATCTGGGAGCCCATCTGTACGGGCGCCCGTTTCCTACAGCTGGTCATCATCTTCGTCCCC
GTCCTGGCCGCCGTGCCCGCCCTCTGGCTTGGACGTCGGCAACGGCATCGCGACGATGAGAGGAGCGGCACCCTC
TGGTGGTACGGACTCCTCGTCCAATCCATGGAATGGGCCGGCCCGGCCTTTATCAAACTCGGTCAGTGGGCAGCC
TCGCGGTCCGATCTCCTCCCGACGGAGATGTGTGAGATGATGTCGAGGCTGCACTCGCACGCGCCCGCCCACTCG
ATGCGCCAGACTCGCGAGACGGTGAGCGCCGCCTTTGACGGCCGCTCCCTGGAAGACGTCTTCGACGAATTCGAC
GAGACGCCCCTCGGCGTCGGCGCCATCGCCCAAGTCTATCGAGCGAGGCTGAAGCCCGATCTCATGGCCCCGGCC
GACGCCGACGTGGCGACGCCGCATCCGCCAGCCTTGTCGGACAACGTACGGCGGCATGTCGACTCGGTGCTCAAG
AGGTCGCCTCAGCGCGTTCCTTCGAGCTTCGTCGCCGTCAAGGTGCTGCACCCAAACGTCGAGCGCACCGTCCGA
AGGGACTTGACCATCATGGGCTTCTTCGCTTCCATCCTCAACGCCATCCCTACCATAGAGTGGCTCTCGCTCCCT
GACGAGGTGGCTCAGTTCGGCGCCATGATGCGTCTGCAGCTCGACCTGCGGATCGAAGCCGCCAATCTCGAAACG
TTCCGCCAGAACTTCAAGCACCGCTCAACCGCCTGGTTCCCGTATCCCTACACCCAGTTCACGACACGTAACCTG
CTAGTCGAGGAGTACGCCCACGGCATCCCGCTCGCCGACTTCTTGGAAAACGGCGGCGGCGTGTTCCAGCACGAC
ATCGCCGACGAGGGCCTCGACGCCTTTCTGCACATGCTGCTCATCGACAACTTCGTCCACGCAGACCTCCATCCG
GGCAACATCATGGTCCGCTTTTATCAGACGGCCCGACCCGAGTTGCGTCTCCGTAGGTCCCGCGACAAGCCTCTT
CCCGCCAGCGACGAAGACGAGGCGGCCGACGTAACGGAGCGCGTGCTCGAGCGTCTGCGACCCTTTCGCCATCGC
AAGAACCAGGCTGCGTGGGAGGCCGAGCTAGCCAGCATCGACGCCGAGGGCTATCGGCCGCAGCTCGTCTTCATC
GACACGGGCCTCGTGACGGAGCTGAGCGAGACGAACCGGGCCAACTTTCTGGCCCTGTTCCGGGCCGTGGCCGAG
TTCGACGGTTACAAAGCCGGACACCTCATGTGCGAGCGCTGCCGGCAGCCGGACGCCGTGCTGGAGCAGGAGATT
TTCGCCCTCAAGATGCAGCATCTGGTATTGGGCGTCAAGCGTCGTACGCTCGCCCTCGGCGCCGTCAAGATCGGA
GACATCCTACAGCGTGTGCTGGCCATGGTTCGCCATCACCACGTCCGTCTCGAGGGCGACTTCGTCAACGTCGTT
CTCAGCATCTTGTTGCTCGAGGGAATCGGCCGTAGTCTGAGTCCGGACGTCGACCTCCTCAGCAGCTCGTTGCCC
ATTCTTCGTCAGCTGAGCGCCCAGAGCGGTGCAGAGATGGCCAAGCAGGGCGATTTTTCCATGTTGGTCGTCTGG
ATGGGCCTTGAGACGAGAAAGTTTCTTCAAGCCAGCGTCGAGGACGTGAGTCGGTTTTTTTTTTTTTCCTTTTCT
TTTTTCTCCCTTCTTGACTTTCGCTCTTTTGGGAATCACCGTTCTTTTGAACCCGTCCTATCCTCGCTGCTGACT
GACGACATCCATCTGCCCAGGTTGAACGCTGTGTCAAGTCTGATCTCTTGTCACCCAACGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail