Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2471
Gene name
Locationscaffold_204:13923..16934
Strand+
Gene length (bp)3011
Transcript length (bp)2886
Coding sequence length (bp)2883
Protein length (aa) 961

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|E5QZI4|MEP7_ARTGP Extracellular metalloprotease MGYG_00389 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00389 PE=3 SV=1 122 221 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 7.03 3.04 11.01
CcL In ants, during behavior modification 7.18 3.09 11.27
CcD In ants, recently dead 6.12 2.54 9.71

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.951276 no
SC16a CcD 0.680820 no
CcL CcD 0.629397 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2471
MLLSPVLIAAFTAAATVTARFHCGASDGITDTTEGMRALLRRAQEDDKWSYNNITAKGNETIEMKSVVHFCCVSK
EDCPGNSTASQATEEKNRLLGPANIVFNLINFTQIIDKRCGAVSLKEEDMAVVDGLKARTRQGGVDTLNLMILPV
KGEGSSTVGLCYLPTLDMKGKNRTISQVIGKKDGCSVFLEEYWHGNNPTDSHETGHWLGLPHVKGASQKPGLNIM
LPSHDMNPTTNYTLEKDQSTIMRQIALIRLAQAKEEGDLKPAGGDLFNGTDYPGHVPGGNTGGGYGNTGKSGPRY
NAAGDGNNSNVPDSETPSSPDNGSGDAPSDSNGEDDFPKDSASRKPFSVGDQDGSNGRGLGDESSNDKGATERFR
GLKDGLRNKTRLSNTTSTASFTTIPTLKTRLSSPTTTAGIRPTDRTGGSRGSSVSSRLGGFGGDAKSSRQLGQEL
RPHTTRAVFPTRSGREPWKMPTPTSNLGNRRRPQRDPAGSQTKEEKAGGSRDLDANRLPAAADDASFSENLIGDP
GVPKKEKNGKKVDRAGKAVTPTSSRSSGDGKARGSASTRPRDDDMNGVSSPAGREPVSDLLKKKKTVGESSSRSS
SSLGGLSGAGKSVSRPASPASSDVVPSRAGRKGQSPSDGRSPTSFGPRPSSFASSDRVAPSRPRKEAQSLPDERS
PTSSRTRPPSPTSSDRVPSRAGRKAQSPSDGRSLTSSRTRPPSPTSSNRAPSRPGREAQSFPNGRSLTSSRTRPP
SPASSSTSPPRRSKETLGNVDTTSPSQSPSRIRQDLGGSGGSGIKGPPIPQQSSSPSSPSGGSGPRRKTTLEKND
QRPNIPKSPLPATVPKDPAASSLNVAPSRRRRESPNAAGSFGGGADRTSSAVESNPRRPETTHSTGDGATWPSSS
RGGASRSRGPSQSPQRPNKSIDGQTPSTGSSSGDAGAAAKQHPPSVRGSLGGSGSGSRPVR
Coding >Ophio5|2471
ATGCTGTTGTCCCCTGTCCTCATAGCCGCCTTCACGGCAGCCGCTACGGTGACGGCGCGCTTCCACTGCGGCGCG
TCAGACGGCATTACAGACACGACGGAGGGGATGAGGGCGTTATTGCGACGAGCGCAGGAGGATGACAAGTGGTCA
TACAACAATATAACAGCAAAGGGCAACGAAACCATTGAAATGAAGTCTGTGGTACACTTTTGCTGTGTGTCGAAG
GAAGATTGTCCCGGTAATAGTACTGCCAGCCAGGCTACCGAGGAGAAGAATCGTTTACTCGGGCCGGCGAACATT
GTGTTCAATCTCATCAACTTCACTCAAATCATTGACAAACGCTGCGGTGCTGTGTCATTGAAAGAAGAGGATATG
GCGGTGGTAGATGGATTGAAAGCAAGGACGCGTCAAGGAGGCGTGGACACGCTCAATCTCATGATCCTGCCCGTT
AAAGGCGAGGGATCTTCCACAGTCGGGCTCTGCTACCTCCCTACGCTTGATATGAAGGGAAAAAATCGAACGATC
AGTCAGGTGATAGGGAAGAAAGACGGATGCTCCGTCTTCCTCGAGGAGTACTGGCATGGGAATAACCCAACAGAT
TCCCACGAGACAGGACACTGGCTTGGCCTGCCCCATGTAAAAGGAGCATCCCAGAAGCCGGGGCTCAATATCATG
CTACCGAGTCACGACATGAATCCGACAACAAATTATACCCTGGAGAAAGACCAGAGCACCATAATGCGACAAATA
GCGTTGATACGGCTGGCACAAGCGAAAGAGGAGGGTGATTTAAAACCTGCCGGGGGCGACCTATTCAACGGAACT
GATTACCCTGGCCACGTTCCTGGCGGTAATACCGGTGGCGGCTACGGAAACACTGGCAAATCGGGTCCCAGATAT
AACGCAGCAGGCGATGGTAACAATTCCAACGTCCCAGACTCTGAAACCCCGTCATCACCCGACAACGGCTCAGGC
GATGCCCCCTCCGATTCGAATGGTGAAGACGACTTCCCCAAAGATTCGGCCAGCAGGAAACCTTTTTCCGTTGGT
GACCAAGATGGCAGTAACGGCAGAGGGTTAGGAGACGAAAGCAGCAATGATAAAGGCGCTACAGAAAGATTTAGA
GGCCTCAAGGACGGATTGCGCAACAAGACGCGGTTGAGCAACACGACTTCCACCGCGTCCTTTACCACAATTCCC
ACCTTGAAAACCAGGCTATCATCACCTACCACTACGGCCGGCATCAGGCCGACTGACCGCACCGGCGGCAGTAGG
GGCTCTTCAGTTTCCAGCCGGCTTGGCGGCTTCGGCGGGGATGCCAAGAGCAGCAGACAGTTGGGTCAAGAGTTG
AGGCCCCATACTACTCGGGCAGTGTTCCCGACCCGCAGCGGTCGAGAGCCTTGGAAGATGCCGACTCCCACGTCG
AACTTGGGCAACAGAAGAAGGCCTCAAAGAGATCCAGCCGGCTCCCAGACCAAAGAGGAGAAGGCTGGTGGCTCG
CGTGACCTGGACGCGAATCGCTTGCCCGCCGCCGCCGATGATGCCAGCTTCAGTGAGAATTTGATAGGCGATCCG
GGGGTCCCTAAGAAGGAGAAGAATGGCAAAAAGGTTGACAGGGCAGGGAAAGCCGTCACTCCGACTTCCTCCCGC
TCTTCCGGCGATGGGAAAGCGAGAGGGTCGGCTTCTACCCGGCCAAGAGACGACGACATGAACGGGGTTTCGAGT
CCGGCTGGCAGAGAACCGGTTTCGGACCTTTTGAAGAAGAAGAAGACGGTCGGAGAGTCAAGCTCTCGATCGTCT
TCATCGCTTGGTGGTTTGAGCGGTGCTGGGAAGTCGGTGTCGCGGCCTGCCTCTCCCGCCTCGTCTGACGTGGTC
CCCTCTCGCGCTGGGAGGAAAGGCCAGAGTCCCTCTGACGGACGCTCTCCTACCAGCTTCGGGCCTCGGCCCTCT
TCCTTCGCCTCCTCTGATAGGGTCGCACCCTCTCGCCCTAGGAAGGAAGCCCAGAGTCTCCCTGATGAACGCTCT
CCTACCAGCTCCAGAACTCGGCCCCCCTCTCCCACCTCGTCTGATAGGGTCCCCTCTCGCGCTGGGAGGAAAGCC
CAGAGTCCCTCAGATGGACGCTCTCTTACCAGCTCCAGAACTCGGCCCCCCTCTCCCACCTCGTCTAATAGGGCC
CCCTCTCGTCCCGGGAGGGAAGCCCAGAGTTTCCCTAATGGACGCTCTCTTACCAGCTCTAGAACTCGGCCCCCC
TCTCCCGCCTCCTCTAGTACGTCCCCGCCTCGCAGGAGCAAGGAAACCCTCGGCAATGTCGACACCACGTCCCCA
TCGCAATCGCCAAGTAGGATACGACAAGACCTTGGCGGCTCTGGGGGTTCAGGCATAAAGGGGCCCCCCATTCCT
CAACAGTCATCGTCCCCCTCCTCCCCGTCTGGCGGCAGCGGTCCTCGGCGCAAGACAACGTTGGAAAAGAATGAT
CAAAGGCCGAACATCCCCAAGAGTCCACTTCCCGCCACGGTACCCAAAGATCCTGCCGCCTCGTCTCTCAATGTC
GCCCCCTCTCGCAGAAGAAGAGAAAGTCCAAACGCTGCTGGCTCTTTCGGCGGCGGTGCTGACAGAACATCATCT
GCAGTCGAATCGAACCCTAGGCGTCCGGAAACTACTCATTCCACAGGCGATGGCGCAACTTGGCCATCCTCCTCT
CGTGGCGGCGCCTCCCGCTCCAGAGGCCCAAGTCAAAGCCCTCAACGGCCGAACAAATCTATCGACGGCCAAACA
CCATCTACAGGCAGCAGTTCGGGCGATGCAGGGGCGGCGGCAAAACAGCATCCCCCATCCGTCAGAGGTTCTCTC
GGGGGTAGCGGCAGCGGCAGCCGTCCAGTTAGG
Transcript >Ophio5|2471
ATGCTGTTGTCCCCTGTCCTCATAGCCGCCTTCACGGCAGCCGCTACGGTGACGGCGCGCTTCCACTGCGGCGCG
TCAGACGGCATTACAGACACGACGGAGGGGATGAGGGCGTTATTGCGACGAGCGCAGGAGGATGACAAGTGGTCA
TACAACAATATAACAGCAAAGGGCAACGAAACCATTGAAATGAAGTCTGTGGTACACTTTTGCTGTGTGTCGAAG
GAAGATTGTCCCGGTAATAGTACTGCCAGCCAGGCTACCGAGGAGAAGAATCGTTTACTCGGGCCGGCGAACATT
GTGTTCAATCTCATCAACTTCACTCAAATCATTGACAAACGCTGCGGTGCTGTGTCATTGAAAGAAGAGGATATG
GCGGTGGTAGATGGATTGAAAGCAAGGACGCGTCAAGGAGGCGTGGACACGCTCAATCTCATGATCCTGCCCGTT
AAAGGCGAGGGATCTTCCACAGTCGGGCTCTGCTACCTCCCTACGCTTGATATGAAGGGAAAAAATCGAACGATC
AGTCAGGTGATAGGGAAGAAAGACGGATGCTCCGTCTTCCTCGAGGAGTACTGGCATGGGAATAACCCAACAGAT
TCCCACGAGACAGGACACTGGCTTGGCCTGCCCCATGTAAAAGGAGCATCCCAGAAGCCGGGGCTCAATATCATG
CTACCGAGTCACGACATGAATCCGACAACAAATTATACCCTGGAGAAAGACCAGAGCACCATAATGCGACAAATA
GCGTTGATACGGCTGGCACAAGCGAAAGAGGAGGGTGATTTAAAACCTGCCGGGGGCGACCTATTCAACGGAACT
GATTACCCTGGCCACGTTCCTGGCGGTAATACCGGTGGCGGCTACGGAAACACTGGCAAATCGGGTCCCAGATAT
AACGCAGCAGGCGATGGTAACAATTCCAACGTCCCAGACTCTGAAACCCCGTCATCACCCGACAACGGCTCAGGC
GATGCCCCCTCCGATTCGAATGGTGAAGACGACTTCCCCAAAGATTCGGCCAGCAGGAAACCTTTTTCCGTTGGT
GACCAAGATGGCAGTAACGGCAGAGGGTTAGGAGACGAAAGCAGCAATGATAAAGGCGCTACAGAAAGATTTAGA
GGCCTCAAGGACGGATTGCGCAACAAGACGCGGTTGAGCAACACGACTTCCACCGCGTCCTTTACCACAATTCCC
ACCTTGAAAACCAGGCTATCATCACCTACCACTACGGCCGGCATCAGGCCGACTGACCGCACCGGCGGCAGTAGG
GGCTCTTCAGTTTCCAGCCGGCTTGGCGGCTTCGGCGGGGATGCCAAGAGCAGCAGACAGTTGGGTCAAGAGTTG
AGGCCCCATACTACTCGGGCAGTGTTCCCGACCCGCAGCGGTCGAGAGCCTTGGAAGATGCCGACTCCCACGTCG
AACTTGGGCAACAGAAGAAGGCCTCAAAGAGATCCAGCCGGCTCCCAGACCAAAGAGGAGAAGGCTGGTGGCTCG
CGTGACCTGGACGCGAATCGCTTGCCCGCCGCCGCCGATGATGCCAGCTTCAGTGAGAATTTGATAGGCGATCCG
GGGGTCCCTAAGAAGGAGAAGAATGGCAAAAAGGTTGACAGGGCAGGGAAAGCCGTCACTCCGACTTCCTCCCGC
TCTTCCGGCGATGGGAAAGCGAGAGGGTCGGCTTCTACCCGGCCAAGAGACGACGACATGAACGGGGTTTCGAGT
CCGGCTGGCAGAGAACCGGTTTCGGACCTTTTGAAGAAGAAGAAGACGGTCGGAGAGTCAAGCTCTCGATCGTCT
TCATCGCTTGGTGGTTTGAGCGGTGCTGGGAAGTCGGTGTCGCGGCCTGCCTCTCCCGCCTCGTCTGACGTGGTC
CCCTCTCGCGCTGGGAGGAAAGGCCAGAGTCCCTCTGACGGACGCTCTCCTACCAGCTTCGGGCCTCGGCCCTCT
TCCTTCGCCTCCTCTGATAGGGTCGCACCCTCTCGCCCTAGGAAGGAAGCCCAGAGTCTCCCTGATGAACGCTCT
CCTACCAGCTCCAGAACTCGGCCCCCCTCTCCCACCTCGTCTGATAGGGTCCCCTCTCGCGCTGGGAGGAAAGCC
CAGAGTCCCTCAGATGGACGCTCTCTTACCAGCTCCAGAACTCGGCCCCCCTCTCCCACCTCGTCTAATAGGGCC
CCCTCTCGTCCCGGGAGGGAAGCCCAGAGTTTCCCTAATGGACGCTCTCTTACCAGCTCTAGAACTCGGCCCCCC
TCTCCCGCCTCCTCTAGTACGTCCCCGCCTCGCAGGAGCAAGGAAACCCTCGGCAATGTCGACACCACGTCCCCA
TCGCAATCGCCAAGTAGGATACGACAAGACCTTGGCGGCTCTGGGGGTTCAGGCATAAAGGGGCCCCCCATTCCT
CAACAGTCATCGTCCCCCTCCTCCCCGTCTGGCGGCAGCGGTCCTCGGCGCAAGACAACGTTGGAAAAGAATGAT
CAAAGGCCGAACATCCCCAAGAGTCCACTTCCCGCCACGGTACCCAAAGATCCTGCCGCCTCGTCTCTCAATGTC
GCCCCCTCTCGCAGAAGAAGAGAAAGTCCAAACGCTGCTGGCTCTTTCGGCGGCGGTGCTGACAGAACATCATCT
GCAGTCGAATCGAACCCTAGGCGTCCGGAAACTACTCATTCCACAGGCGATGGCGCAACTTGGCCATCCTCCTCT
CGTGGCGGCGCCTCCCGCTCCAGAGGCCCAAGTCAAAGCCCTCAACGGCCGAACAAATCTATCGACGGCCAAACA
CCATCTACAGGCAGCAGTTCGGGCGATGCAGGGGCGGCGGCAAAACAGCATCCCCCATCCGTCAGAGGTTCTCTC
GGGGGTAGCGGCAGCGGCAGCCGTCCAGTTAGGTAG
Gene >Ophio5|2471
ATGCTGTTGTCCCCTGTCCTCATAGCCGCCTTCACGGCAGCCGCTACGGTGACGGCGCGCTTCCACTGCGGCGCG
TCAGACGGCATTACAGACACGACGGAGGGGATGAGGGCGTTATTGCGACGAGCGCAGGAGGATGACAAGTGGTCA
TACAACAATATAACAGCAAAGGGCAACGAAACCATTGAAATGAAGTCTGTGGTACACTTTTGCTGTGTGTCGAAG
GAAGATTGTCCCGGTGTAAGTTGCTGCTCGCTGAGCACAGACGGAGCGACTTGACTAATGCCGTTTCACCGCGCG
CAGAATAGTACTGCCAGCCAGGCTACCGAGGAGAAGAATCGTTTACTCGGGCCGGCGAACATTGTGTTCAATCTC
ATCAACTTCACTCAAATCATTGACAAACGCTGCGGTGCTGTGTCATTGAAAGAAGAGGATATGGCGGTGGTAGAT
GGATTGAAAGCAAGGACGCGTCAAGGAGGCGTGGACACGCTCAATCTCATGATCCTGCCCGTTAAAGGCGAGGGA
TCTTCCACAGTCGGGCTCTGCTACCTCCCTACGCTTGATATGAAGGGAAAAAATCGAACGATCAGTCAGGTGATA
GGGAAGAAAGACGGATGCTCCGTCTTCCTCGAGGAGTACTGGCATGGGAATAACCCAACAGATTCCCACGAGACA
GGACACTGGCTTGGCCTGCCCCATGTAAAAGGAGCATCCCAGAAGCCGGGGCTCAATATCATGCTACCGAGTCAC
GACATGAAGTTTGTCCCCCTCTTTTTTTCTCCATATTCTGTTGCTCGGACCTAATGATGATGGATGGCAGTCCGA
CAACAAATTATACCCTGGAGAAAGACCAGAGCACCATAATGCGACAAATAGCGTTGATACGGCTGGCACAAGCGA
AAGAGGAGGGTGATTTAAAACCTGCCGGGGGCGACCTATTCAACGGAACTGATTACCCTGGCCACGTTCCTGGCG
GTAATACCGGTGGCGGCTACGGAAACACTGGCAAATCGGGTCCCAGATATAACGCAGCAGGCGATGGTAACAATT
CCAACGTCCCAGACTCTGAAACCCCGTCATCACCCGACAACGGCTCAGGCGATGCCCCCTCCGATTCGAATGGTG
AAGACGACTTCCCCAAAGATTCGGCCAGCAGGAAACCTTTTTCCGTTGGTGACCAAGATGGCAGTAACGGCAGAG
GGTTAGGAGACGAAAGCAGCAATGATAAAGGCGCTACAGAAAGATTTAGAGGCCTCAAGGACGGATTGCGCAACA
AGACGCGGTTGAGCAACACGACTTCCACCGCGTCCTTTACCACAATTCCCACCTTGAAAACCAGGCTATCATCAC
CTACCACTACGGCCGGCATCAGGCCGACTGACCGCACCGGCGGCAGTAGGGGCTCTTCAGTTTCCAGCCGGCTTG
GCGGCTTCGGCGGGGATGCCAAGAGCAGCAGACAGTTGGGTCAAGAGTTGAGGCCCCATACTACTCGGGCAGTGT
TCCCGACCCGCAGCGGTCGAGAGCCTTGGAAGATGCCGACTCCCACGTCGAACTTGGGCAACAGAAGAAGGCCTC
AAAGAGATCCAGCCGGCTCCCAGACCAAAGAGGAGAAGGCTGGTGGCTCGCGTGACCTGGACGCGAATCGCTTGC
CCGCCGCCGCCGATGATGCCAGCTTCAGTGAGAATTTGATAGGCGATCCGGGGGTCCCTAAGAAGGAGAAGAATG
GCAAAAAGGTTGACAGGGCAGGGAAAGCCGTCACTCCGACTTCCTCCCGCTCTTCCGGCGATGGGAAAGCGAGAG
GGTCGGCTTCTACCCGGCCAAGAGACGACGACATGAACGGGGTTTCGAGTCCGGCTGGCAGAGAACCGGTTTCGG
ACCTTTTGAAGAAGAAGAAGACGGTCGGAGAGTCAAGCTCTCGATCGTCTTCATCGCTTGGTGGTTTGAGCGGTG
CTGGGAAGTCGGTGTCGCGGCCTGCCTCTCCCGCCTCGTCTGACGTGGTCCCCTCTCGCGCTGGGAGGAAAGGCC
AGAGTCCCTCTGACGGACGCTCTCCTACCAGCTTCGGGCCTCGGCCCTCTTCCTTCGCCTCCTCTGATAGGGTCG
CACCCTCTCGCCCTAGGAAGGAAGCCCAGAGTCTCCCTGATGAACGCTCTCCTACCAGCTCCAGAACTCGGCCCC
CCTCTCCCACCTCGTCTGATAGGGTCCCCTCTCGCGCTGGGAGGAAAGCCCAGAGTCCCTCAGATGGACGCTCTC
TTACCAGCTCCAGAACTCGGCCCCCCTCTCCCACCTCGTCTAATAGGGCCCCCTCTCGTCCCGGGAGGGAAGCCC
AGAGTTTCCCTAATGGACGCTCTCTTACCAGCTCTAGAACTCGGCCCCCCTCTCCCGCCTCCTCTAGTACGTCCC
CGCCTCGCAGGAGCAAGGAAACCCTCGGCAATGTCGACACCACGTCCCCATCGCAATCGCCAAGTAGGATACGAC
AAGACCTTGGCGGCTCTGGGGGTTCAGGCATAAAGGGGCCCCCCATTCCTCAACAGTCATCGTCCCCCTCCTCCC
CGTCTGGCGGCAGCGGTCCTCGGCGCAAGACAACGTTGGAAAAGAATGATCAAAGGCCGAACATCCCCAAGAGTC
CACTTCCCGCCACGGTACCCAAAGATCCTGCCGCCTCGTCTCTCAATGTCGCCCCCTCTCGCAGAAGAAGAGAAA
GTCCAAACGCTGCTGGCTCTTTCGGCGGCGGTGCTGACAGAACATCATCTGCAGTCGAATCGAACCCTAGGCGTC
CGGAAACTACTCATTCCACAGGCGATGGCGCAACTTGGCCATCCTCCTCTCGTGGCGGCGCCTCCCGCTCCAGAG
GCCCAAGTCAAAGCCCTCAACGGCCGAACAAATCTATCGACGGCCAAACACCATCTACAGGCAGCAGTTCGGGCG
ATGCAGGGGCGGCGGCAAAACAGCATCCCCCATCCGTCAGAGGTTCTCTCGGGGGTAGCGGCAGCGGCAGCCGTC
CAGTTAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail