Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2471
Gene name
Locationscaffold_204:13923..16934
Strand+
Gene length (bp)3011
Transcript length (bp)2886
Coding sequence length (bp)2883
Protein length (aa) 961

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|E5QZI4|MEP7_ARTGP Extracellular metalloprotease MGYG_00389 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00389 PE=3 SV=1 122 221 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2471
MLLSPVLIAAFTAAATVTARFHCGASDGITDTTEGMRALLRRAQEDDKWSYNNITAKGNETIEMKSVVHFCCVSK
EDCPGNSTASQATEEKNRLLGPANIVFNLINFTQIIDKRCGAVSLKEEDMAVVDGLKARTRQGGVDTLNLMILPV
KGEGSSTVGLCYLPTLDMKGKNRTISQVIGKKDGCSVFLEEYWHGNNPTDSHETGHWLGLPHVKGASQKPGLNIM
LPSHDMNPTTNYTLEKDQSTIMRQIALIRLAQAKEEGDLKPAGGDLFNGTDYPGHVPGGNTGGGYGNTGKSGPRY
NAAGDGNNSNVPDSETPSSPDNGSGDAPSDSNGEDDFPKDSASRKPFSVGDQDGSNGRGLGDESSNDKGATERFR
GLKDGLRNKTRLSNTTSTASFTTIPTLKTRLSSPTTTAGIRPTDRTGGSRGSSVSSRLGGFGGDAKSSRQLGQEL
RPHTTRAVFPTRSGREPWKMPTPTSNLGNRRRPQRDPAGSQTKEEKAGGSRDLDANRLPAAADDASFSENLIGDP
GVPKKEKNGKKVDRAGKAVTPTSSRSSGDGKARGSASTRPRDDDMNGVSSPAGREPVSDLLKKKKTVGESSSRSS
SSLGGLSGAGKSVSRPASPASSDVVPSRAGRKGQSPSDGRSPTSFGPRPSSFASSDRVAPSRPRKEAQSLPDERS
PTSSRTRPPSPTSSDRVPSRAGRKAQSPSDGRSLTSSRTRPPSPTSSNRAPSRPGREAQSFPNGRSLTSSRTRPP
SPASSSTSPPRRSKETLGNVDTTSPSQSPSRIRQDLGGSGGSGIKGPPIPQQSSSPSSPSGGSGPRRKTTLEKND
QRPNIPKSPLPATVPKDPAASSLNVAPSRRRRESPNAAGSFGGGADRTSSAVESNPRRPETTHSTGDGATWPSSS
RGGASRSRGPSQSPQRPNKSIDGQTPSTGSSSGDAGAAAKQHPPSVRGSLGGSGSGSRPVR
Coding >Ophio5|2471
ATGCTGTTGTCCCCTGTCCTCATAGCCGCCTTCACGGCAGCCGCTACGGTGACGGCGCGCTTCCACTGCGGCGCG
TCAGACGGCATTACAGACACGACGGAGGGGATGAGGGCGTTATTGCGACGAGCGCAGGAGGATGACAAGTGGTCA
TACAACAATATAACAGCAAAGGGCAACGAAACCATTGAAATGAAGTCTGTGGTACACTTTTGCTGTGTGTCGAAG
GAAGATTGTCCCGGTAATAGTACTGCCAGCCAGGCTACCGAGGAGAAGAATCGTTTACTCGGGCCGGCGAACATT
GTGTTCAATCTCATCAACTTCACTCAAATCATTGACAAACGCTGCGGTGCTGTGTCATTGAAAGAAGAGGATATG
GCGGTGGTAGATGGATTGAAAGCAAGGACGCGTCAAGGAGGCGTGGACACGCTCAATCTCATGATCCTGCCCGTT
AAAGGCGAGGGATCTTCCACAGTCGGGCTCTGCTACCTCCCTACGCTTGATATGAAGGGAAAAAATCGAACGATC
AGTCAGGTGATAGGGAAGAAAGACGGATGCTCCGTCTTCCTCGAGGAGTACTGGCATGGGAATAACCCAACAGAT
TCCCACGAGACAGGACACTGGCTTGGCCTGCCCCATGTAAAAGGAGCATCCCAGAAGCCGGGGCTCAATATCATG
CTACCGAGTCACGACATGAATCCGACAACAAATTATACCCTGGAGAAAGACCAGAGCACCATAATGCGACAAATA
GCGTTGATACGGCTGGCACAAGCGAAAGAGGAGGGTGATTTAAAACCTGCCGGGGGCGACCTATTCAACGGAACT
GATTACCCTGGCCACGTTCCTGGCGGTAATACCGGTGGCGGCTACGGAAACACTGGCAAATCGGGTCCCAGATAT
AACGCAGCAGGCGATGGTAACAATTCCAACGTCCCAGACTCTGAAACCCCGTCATCACCCGACAACGGCTCAGGC
GATGCCCCCTCCGATTCGAATGGTGAAGACGACTTCCCCAAAGATTCGGCCAGCAGGAAACCTTTTTCCGTTGGT
GACCAAGATGGCAGTAACGGCAGAGGGTTAGGAGACGAAAGCAGCAATGATAAAGGCGCTACAGAAAGATTTAGA
GGCCTCAAGGACGGATTGCGCAACAAGACGCGGTTGAGCAACACGACTTCCACCGCGTCCTTTACCACAATTCCC
ACCTTGAAAACCAGGCTATCATCACCTACCACTACGGCCGGCATCAGGCCGACTGACCGCACCGGCGGCAGTAGG
GGCTCTTCAGTTTCCAGCCGGCTTGGCGGCTTCGGCGGGGATGCCAAGAGCAGCAGACAGTTGGGTCAAGAGTTG
AGGCCCCATACTACTCGGGCAGTGTTCCCGACCCGCAGCGGTCGAGAGCCTTGGAAGATGCCGACTCCCACGTCG
AACTTGGGCAACAGAAGAAGGCCTCAAAGAGATCCAGCCGGCTCCCAGACCAAAGAGGAGAAGGCTGGTGGCTCG
CGTGACCTGGACGCGAATCGCTTGCCCGCCGCCGCCGATGATGCCAGCTTCAGTGAGAATTTGATAGGCGATCCG
GGGGTCCCTAAGAAGGAGAAGAATGGCAAAAAGGTTGACAGGGCAGGGAAAGCCGTCACTCCGACTTCCTCCCGC
TCTTCCGGCGATGGGAAAGCGAGAGGGTCGGCTTCTACCCGGCCAAGAGACGACGACATGAACGGGGTTTCGAGT
CCGGCTGGCAGAGAACCGGTTTCGGACCTTTTGAAGAAGAAGAAGACGGTCGGAGAGTCAAGCTCTCGATCGTCT
TCATCGCTTGGTGGTTTGAGCGGTGCTGGGAAGTCGGTGTCGCGGCCTGCCTCTCCCGCCTCGTCTGACGTGGTC
CCCTCTCGCGCTGGGAGGAAAGGCCAGAGTCCCTCTGACGGACGCTCTCCTACCAGCTTCGGGCCTCGGCCCTCT
TCCTTCGCCTCCTCTGATAGGGTCGCACCCTCTCGCCCTAGGAAGGAAGCCCAGAGTCTCCCTGATGAACGCTCT
CCTACCAGCTCCAGAACTCGGCCCCCCTCTCCCACCTCGTCTGATAGGGTCCCCTCTCGCGCTGGGAGGAAAGCC
CAGAGTCCCTCAGATGGACGCTCTCTTACCAGCTCCAGAACTCGGCCCCCCTCTCCCACCTCGTCTAATAGGGCC
CCCTCTCGTCCCGGGAGGGAAGCCCAGAGTTTCCCTAATGGACGCTCTCTTACCAGCTCTAGAACTCGGCCCCCC
TCTCCCGCCTCCTCTAGTACGTCCCCGCCTCGCAGGAGCAAGGAAACCCTCGGCAATGTCGACACCACGTCCCCA
TCGCAATCGCCAAGTAGGATACGACAAGACCTTGGCGGCTCTGGGGGTTCAGGCATAAAGGGGCCCCCCATTCCT
CAACAGTCATCGTCCCCCTCCTCCCCGTCTGGCGGCAGCGGTCCTCGGCGCAAGACAACGTTGGAAAAGAATGAT
CAAAGGCCGAACATCCCCAAGAGTCCACTTCCCGCCACGGTACCCAAAGATCCTGCCGCCTCGTCTCTCAATGTC
GCCCCCTCTCGCAGAAGAAGAGAAAGTCCAAACGCTGCTGGCTCTTTCGGCGGCGGTGCTGACAGAACATCATCT
GCAGTCGAATCGAACCCTAGGCGTCCGGAAACTACTCATTCCACAGGCGATGGCGCAACTTGGCCATCCTCCTCT
CGTGGCGGCGCCTCCCGCTCCAGAGGCCCAAGTCAAAGCCCTCAACGGCCGAACAAATCTATCGACGGCCAAACA
CCATCTACAGGCAGCAGTTCGGGCGATGCAGGGGCGGCGGCAAAACAGCATCCCCCATCCGTCAGAGGTTCTCTC
GGGGGTAGCGGCAGCGGCAGCCGTCCAGTTAGG
Transcript >Ophio5|2471
ATGCTGTTGTCCCCTGTCCTCATAGCCGCCTTCACGGCAGCCGCTACGGTGACGGCGCGCTTCCACTGCGGCGCG
TCAGACGGCATTACAGACACGACGGAGGGGATGAGGGCGTTATTGCGACGAGCGCAGGAGGATGACAAGTGGTCA
TACAACAATATAACAGCAAAGGGCAACGAAACCATTGAAATGAAGTCTGTGGTACACTTTTGCTGTGTGTCGAAG
GAAGATTGTCCCGGTAATAGTACTGCCAGCCAGGCTACCGAGGAGAAGAATCGTTTACTCGGGCCGGCGAACATT
GTGTTCAATCTCATCAACTTCACTCAAATCATTGACAAACGCTGCGGTGCTGTGTCATTGAAAGAAGAGGATATG
GCGGTGGTAGATGGATTGAAAGCAAGGACGCGTCAAGGAGGCGTGGACACGCTCAATCTCATGATCCTGCCCGTT
AAAGGCGAGGGATCTTCCACAGTCGGGCTCTGCTACCTCCCTACGCTTGATATGAAGGGAAAAAATCGAACGATC
AGTCAGGTGATAGGGAAGAAAGACGGATGCTCCGTCTTCCTCGAGGAGTACTGGCATGGGAATAACCCAACAGAT
TCCCACGAGACAGGACACTGGCTTGGCCTGCCCCATGTAAAAGGAGCATCCCAGAAGCCGGGGCTCAATATCATG
CTACCGAGTCACGACATGAATCCGACAACAAATTATACCCTGGAGAAAGACCAGAGCACCATAATGCGACAAATA
GCGTTGATACGGCTGGCACAAGCGAAAGAGGAGGGTGATTTAAAACCTGCCGGGGGCGACCTATTCAACGGAACT
GATTACCCTGGCCACGTTCCTGGCGGTAATACCGGTGGCGGCTACGGAAACACTGGCAAATCGGGTCCCAGATAT
AACGCAGCAGGCGATGGTAACAATTCCAACGTCCCAGACTCTGAAACCCCGTCATCACCCGACAACGGCTCAGGC
GATGCCCCCTCCGATTCGAATGGTGAAGACGACTTCCCCAAAGATTCGGCCAGCAGGAAACCTTTTTCCGTTGGT
GACCAAGATGGCAGTAACGGCAGAGGGTTAGGAGACGAAAGCAGCAATGATAAAGGCGCTACAGAAAGATTTAGA
GGCCTCAAGGACGGATTGCGCAACAAGACGCGGTTGAGCAACACGACTTCCACCGCGTCCTTTACCACAATTCCC
ACCTTGAAAACCAGGCTATCATCACCTACCACTACGGCCGGCATCAGGCCGACTGACCGCACCGGCGGCAGTAGG
GGCTCTTCAGTTTCCAGCCGGCTTGGCGGCTTCGGCGGGGATGCCAAGAGCAGCAGACAGTTGGGTCAAGAGTTG
AGGCCCCATACTACTCGGGCAGTGTTCCCGACCCGCAGCGGTCGAGAGCCTTGGAAGATGCCGACTCCCACGTCG
AACTTGGGCAACAGAAGAAGGCCTCAAAGAGATCCAGCCGGCTCCCAGACCAAAGAGGAGAAGGCTGGTGGCTCG
CGTGACCTGGACGCGAATCGCTTGCCCGCCGCCGCCGATGATGCCAGCTTCAGTGAGAATTTGATAGGCGATCCG
GGGGTCCCTAAGAAGGAGAAGAATGGCAAAAAGGTTGACAGGGCAGGGAAAGCCGTCACTCCGACTTCCTCCCGC
TCTTCCGGCGATGGGAAAGCGAGAGGGTCGGCTTCTACCCGGCCAAGAGACGACGACATGAACGGGGTTTCGAGT
CCGGCTGGCAGAGAACCGGTTTCGGACCTTTTGAAGAAGAAGAAGACGGTCGGAGAGTCAAGCTCTCGATCGTCT
TCATCGCTTGGTGGTTTGAGCGGTGCTGGGAAGTCGGTGTCGCGGCCTGCCTCTCCCGCCTCGTCTGACGTGGTC
CCCTCTCGCGCTGGGAGGAAAGGCCAGAGTCCCTCTGACGGACGCTCTCCTACCAGCTTCGGGCCTCGGCCCTCT
TCCTTCGCCTCCTCTGATAGGGTCGCACCCTCTCGCCCTAGGAAGGAAGCCCAGAGTCTCCCTGATGAACGCTCT
CCTACCAGCTCCAGAACTCGGCCCCCCTCTCCCACCTCGTCTGATAGGGTCCCCTCTCGCGCTGGGAGGAAAGCC
CAGAGTCCCTCAGATGGACGCTCTCTTACCAGCTCCAGAACTCGGCCCCCCTCTCCCACCTCGTCTAATAGGGCC
CCCTCTCGTCCCGGGAGGGAAGCCCAGAGTTTCCCTAATGGACGCTCTCTTACCAGCTCTAGAACTCGGCCCCCC
TCTCCCGCCTCCTCTAGTACGTCCCCGCCTCGCAGGAGCAAGGAAACCCTCGGCAATGTCGACACCACGTCCCCA
TCGCAATCGCCAAGTAGGATACGACAAGACCTTGGCGGCTCTGGGGGTTCAGGCATAAAGGGGCCCCCCATTCCT
CAACAGTCATCGTCCCCCTCCTCCCCGTCTGGCGGCAGCGGTCCTCGGCGCAAGACAACGTTGGAAAAGAATGAT
CAAAGGCCGAACATCCCCAAGAGTCCACTTCCCGCCACGGTACCCAAAGATCCTGCCGCCTCGTCTCTCAATGTC
GCCCCCTCTCGCAGAAGAAGAGAAAGTCCAAACGCTGCTGGCTCTTTCGGCGGCGGTGCTGACAGAACATCATCT
GCAGTCGAATCGAACCCTAGGCGTCCGGAAACTACTCATTCCACAGGCGATGGCGCAACTTGGCCATCCTCCTCT
CGTGGCGGCGCCTCCCGCTCCAGAGGCCCAAGTCAAAGCCCTCAACGGCCGAACAAATCTATCGACGGCCAAACA
CCATCTACAGGCAGCAGTTCGGGCGATGCAGGGGCGGCGGCAAAACAGCATCCCCCATCCGTCAGAGGTTCTCTC
GGGGGTAGCGGCAGCGGCAGCCGTCCAGTTAGGTAG
Gene >Ophio5|2471
ATGCTGTTGTCCCCTGTCCTCATAGCCGCCTTCACGGCAGCCGCTACGGTGACGGCGCGCTTCCACTGCGGCGCG
TCAGACGGCATTACAGACACGACGGAGGGGATGAGGGCGTTATTGCGACGAGCGCAGGAGGATGACAAGTGGTCA
TACAACAATATAACAGCAAAGGGCAACGAAACCATTGAAATGAAGTCTGTGGTACACTTTTGCTGTGTGTCGAAG
GAAGATTGTCCCGGTGTAAGTTGCTGCTCGCTGAGCACAGACGGAGCGACTTGACTAATGCCGTTTCACCGCGCG
CAGAATAGTACTGCCAGCCAGGCTACCGAGGAGAAGAATCGTTTACTCGGGCCGGCGAACATTGTGTTCAATCTC
ATCAACTTCACTCAAATCATTGACAAACGCTGCGGTGCTGTGTCATTGAAAGAAGAGGATATGGCGGTGGTAGAT
GGATTGAAAGCAAGGACGCGTCAAGGAGGCGTGGACACGCTCAATCTCATGATCCTGCCCGTTAAAGGCGAGGGA
TCTTCCACAGTCGGGCTCTGCTACCTCCCTACGCTTGATATGAAGGGAAAAAATCGAACGATCAGTCAGGTGATA
GGGAAGAAAGACGGATGCTCCGTCTTCCTCGAGGAGTACTGGCATGGGAATAACCCAACAGATTCCCACGAGACA
GGACACTGGCTTGGCCTGCCCCATGTAAAAGGAGCATCCCAGAAGCCGGGGCTCAATATCATGCTACCGAGTCAC
GACATGAAGTTTGTCCCCCTCTTTTTTTCTCCATATTCTGTTGCTCGGACCTAATGATGATGGATGGCAGTCCGA
CAACAAATTATACCCTGGAGAAAGACCAGAGCACCATAATGCGACAAATAGCGTTGATACGGCTGGCACAAGCGA
AAGAGGAGGGTGATTTAAAACCTGCCGGGGGCGACCTATTCAACGGAACTGATTACCCTGGCCACGTTCCTGGCG
GTAATACCGGTGGCGGCTACGGAAACACTGGCAAATCGGGTCCCAGATATAACGCAGCAGGCGATGGTAACAATT
CCAACGTCCCAGACTCTGAAACCCCGTCATCACCCGACAACGGCTCAGGCGATGCCCCCTCCGATTCGAATGGTG
AAGACGACTTCCCCAAAGATTCGGCCAGCAGGAAACCTTTTTCCGTTGGTGACCAAGATGGCAGTAACGGCAGAG
GGTTAGGAGACGAAAGCAGCAATGATAAAGGCGCTACAGAAAGATTTAGAGGCCTCAAGGACGGATTGCGCAACA
AGACGCGGTTGAGCAACACGACTTCCACCGCGTCCTTTACCACAATTCCCACCTTGAAAACCAGGCTATCATCAC
CTACCACTACGGCCGGCATCAGGCCGACTGACCGCACCGGCGGCAGTAGGGGCTCTTCAGTTTCCAGCCGGCTTG
GCGGCTTCGGCGGGGATGCCAAGAGCAGCAGACAGTTGGGTCAAGAGTTGAGGCCCCATACTACTCGGGCAGTGT
TCCCGACCCGCAGCGGTCGAGAGCCTTGGAAGATGCCGACTCCCACGTCGAACTTGGGCAACAGAAGAAGGCCTC
AAAGAGATCCAGCCGGCTCCCAGACCAAAGAGGAGAAGGCTGGTGGCTCGCGTGACCTGGACGCGAATCGCTTGC
CCGCCGCCGCCGATGATGCCAGCTTCAGTGAGAATTTGATAGGCGATCCGGGGGTCCCTAAGAAGGAGAAGAATG
GCAAAAAGGTTGACAGGGCAGGGAAAGCCGTCACTCCGACTTCCTCCCGCTCTTCCGGCGATGGGAAAGCGAGAG
GGTCGGCTTCTACCCGGCCAAGAGACGACGACATGAACGGGGTTTCGAGTCCGGCTGGCAGAGAACCGGTTTCGG
ACCTTTTGAAGAAGAAGAAGACGGTCGGAGAGTCAAGCTCTCGATCGTCTTCATCGCTTGGTGGTTTGAGCGGTG
CTGGGAAGTCGGTGTCGCGGCCTGCCTCTCCCGCCTCGTCTGACGTGGTCCCCTCTCGCGCTGGGAGGAAAGGCC
AGAGTCCCTCTGACGGACGCTCTCCTACCAGCTTCGGGCCTCGGCCCTCTTCCTTCGCCTCCTCTGATAGGGTCG
CACCCTCTCGCCCTAGGAAGGAAGCCCAGAGTCTCCCTGATGAACGCTCTCCTACCAGCTCCAGAACTCGGCCCC
CCTCTCCCACCTCGTCTGATAGGGTCCCCTCTCGCGCTGGGAGGAAAGCCCAGAGTCCCTCAGATGGACGCTCTC
TTACCAGCTCCAGAACTCGGCCCCCCTCTCCCACCTCGTCTAATAGGGCCCCCTCTCGTCCCGGGAGGGAAGCCC
AGAGTTTCCCTAATGGACGCTCTCTTACCAGCTCTAGAACTCGGCCCCCCTCTCCCGCCTCCTCTAGTACGTCCC
CGCCTCGCAGGAGCAAGGAAACCCTCGGCAATGTCGACACCACGTCCCCATCGCAATCGCCAAGTAGGATACGAC
AAGACCTTGGCGGCTCTGGGGGTTCAGGCATAAAGGGGCCCCCCATTCCTCAACAGTCATCGTCCCCCTCCTCCC
CGTCTGGCGGCAGCGGTCCTCGGCGCAAGACAACGTTGGAAAAGAATGATCAAAGGCCGAACATCCCCAAGAGTC
CACTTCCCGCCACGGTACCCAAAGATCCTGCCGCCTCGTCTCTCAATGTCGCCCCCTCTCGCAGAAGAAGAGAAA
GTCCAAACGCTGCTGGCTCTTTCGGCGGCGGTGCTGACAGAACATCATCTGCAGTCGAATCGAACCCTAGGCGTC
CGGAAACTACTCATTCCACAGGCGATGGCGCAACTTGGCCATCCTCCTCTCGTGGCGGCGCCTCCCGCTCCAGAG
GCCCAAGTCAAAGCCCTCAACGGCCGAACAAATCTATCGACGGCCAAACACCATCTACAGGCAGCAGTTCGGGCG
ATGCAGGGGCGGCGGCAAAACAGCATCCCCCATCCGTCAGAGGTTCTCTCGGGGGTAGCGGCAGCGGCAGCCGTC
CAGTTAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail