Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2467
Gene name
Locationscaffold_204:4756..6280
Strand-
Gene length (bp)1524
Transcript length (bp)1524
Coding sequence length (bp)1524
Protein length (aa) 508

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9L7Q2|ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=zmpB PE=3 SV=2 104 310 5.0E-12
sp|Q9L7Q2|ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=zmpB PE=3 SV=2 100 300 2.0E-11
sp|Q9L7Q2|ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=zmpB PE=3 SV=2 101 310 4.0E-11
sp|Q9L7Q2|ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=zmpB PE=3 SV=2 107 297 7.0E-11
sp|Q9L7Q2|ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=zmpB PE=3 SV=2 119 324 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9L7Q2|ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=zmpB PE=3 SV=2 104 310 5.0E-12
sp|Q9L7Q2|ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=zmpB PE=3 SV=2 100 300 2.0E-11
sp|Q9L7Q2|ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=zmpB PE=3 SV=2 101 310 4.0E-11
sp|Q9L7Q2|ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=zmpB PE=3 SV=2 107 297 7.0E-11
sp|Q9L7Q2|ZMPB_STRPN Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=zmpB PE=3 SV=2 119 324 3.0E-09
sp|Q8DQN5|ZMPB_STRR6 Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=zmpB PE=3 SV=1 100 314 1.0E-07
sp|Q8DQN5|ZMPB_STRR6 Zinc metalloprotease ZmpB OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=zmpB PE=3 SV=1 99 296 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2467
MLVSVVSSILVASGAFVSVGAFPCNDCGNGSLTSHSVTMNTVLRALMSTDRKRVAAGELSESKVAAVPENRVEEK
QEFANGIGGAPNGKKNCGRPPVQPQPSVVSSQAQASPQDKTRPQGQPSEGVSESQKQPQEPPTQESSSKPRRKKC
KPRPSKSQSPVESEKKPFTSEPTPKVKPGRKPCKPAPGQSQQPVGDQEQPGEQSSSGNDSDKPAEEKPQPPKIDD
KPAETTGQQPTTPQEPPQEPPQEPAGEPEKPAAESEQPAGEPEKPAEKPQKPATESESEKPAEEPKRPTEEPGKP
AKPQSPQGRPGGKMMATAHVQYASSIGVLGCKGVDLSRIAFFPGTPGCDDFCVKVTYEGRSVNLLRVDSSGSAPS
PDNSGTFDMSCQAYDFLVHGTDNKNSCKTGDRTPMSYETVDPEECKHLLRGGVLPISAPNPNYFVECANSPTFKQ
GSLKLAMFNINDSRCEHGIDEECSWSGVGDPTCPSGLGAGNQRDLPGLQITDPSYGG*
Coding >Ophio5|2467
ATGCTGGTCTCCGTCGTTAGCTCCATTCTCGTCGCCTCTGGCGCTTTCGTTTCTGTCGGAGCCTTCCCGTGCAAT
GACTGCGGCAATGGCTCACTCACTTCCCACTCTGTCACCATGAATACCGTTCTTCGTGCCCTCATGTCGACCGAC
CGGAAGCGCGTCGCGGCCGGCGAGCTGTCCGAGTCGAAAGTCGCCGCCGTTCCCGAGAACCGAGTCGAAGAGAAA
CAGGAGTTCGCCAACGGGATAGGCGGCGCACCGAATGGAAAGAAAAATTGCGGCAGACCTCCTGTTCAGCCGCAA
CCGTCTGTTGTTTCTTCTCAGGCACAGGCTAGCCCTCAGGATAAGACAAGACCTCAGGGTCAGCCCTCTGAAGGT
GTTTCCGAATCCCAGAAGCAGCCGCAGGAGCCCCCAACGCAGGAGTCCTCGAGCAAACCTCGTCGCAAAAAATGC
AAGCCACGCCCCTCCAAGTCTCAATCGCCAGTTGAGTCGGAGAAGAAACCTTTCACTTCGGAACCAACACCCAAG
GTCAAACCTGGTCGTAAACCGTGCAAGCCAGCACCTGGGCAGTCGCAACAGCCCGTCGGGGATCAGGAACAGCCC
GGCGAGCAGTCCTCCAGTGGCAATGACAGTGACAAACCTGCGGAGGAGAAGCCGCAGCCTCCCAAAATCGACGAT
AAGCCGGCCGAGACCACGGGGCAGCAACCAACAACTCCCCAGGAACCTCCCCAGGAACCTCCTCAGGAACCCGCT
GGAGAGCCCGAGAAGCCCGCTGCAGAGTCGGAGCAGCCCGCAGGAGAACCGGAAAAGCCGGCTGAGAAGCCCCAG
AAGCCCGCCACAGAGTCCGAGTCTGAGAAGCCCGCCGAAGAGCCCAAAAGGCCCACTGAAGAGCCCGGAAAACCC
GCCAAGCCTCAGTCACCTCAAGGCCGTCCCGGTGGGAAGATGATGGCCACGGCACACGTCCAGTACGCGTCGTCG
ATTGGCGTCCTCGGCTGCAAGGGCGTCGACCTGAGCCGTATCGCCTTCTTCCCAGGAACACCCGGCTGCGACGAC
TTCTGCGTCAAGGTCACGTACGAGGGCCGCAGCGTCAATCTCCTGCGCGTAGACAGCTCCGGAAGCGCTCCCTCG
CCGGACAACTCGGGCACTTTTGACATGTCGTGCCAGGCATACGACTTTCTCGTCCACGGCACGGACAACAAGAAC
TCGTGCAAGACGGGCGACCGCACTCCCATGAGCTACGAGACGGTCGACCCCGAAGAATGCAAGCATCTTCTTCGA
GGCGGCGTGCTGCCCATCTCGGCGCCCAATCCCAACTATTTTGTTGAGTGTGCAAACTCGCCTACTTTTAAGCAG
GGCAGTCTGAAGCTGGCCATGTTCAACATCAATGACTCGAGGTGCGAGCATGGCATTGACGAGGAGTGCTCCTGG
TCTGGTGTCGGCGATCCTACCTGTCCCAGCGGGCTTGGAGCAGGAAACCAGCGCGATCTGCCGGGTCTTCAGATC
ACGGACCCATCGTATGGTGGCTAG
Transcript >Ophio5|2467
ATGCTGGTCTCCGTCGTTAGCTCCATTCTCGTCGCCTCTGGCGCTTTCGTTTCTGTCGGAGCCTTCCCGTGCAAT
GACTGCGGCAATGGCTCACTCACTTCCCACTCTGTCACCATGAATACCGTTCTTCGTGCCCTCATGTCGACCGAC
CGGAAGCGCGTCGCGGCCGGCGAGCTGTCCGAGTCGAAAGTCGCCGCCGTTCCCGAGAACCGAGTCGAAGAGAAA
CAGGAGTTCGCCAACGGGATAGGCGGCGCACCGAATGGAAAGAAAAATTGCGGCAGACCTCCTGTTCAGCCGCAA
CCGTCTGTTGTTTCTTCTCAGGCACAGGCTAGCCCTCAGGATAAGACAAGACCTCAGGGTCAGCCCTCTGAAGGT
GTTTCCGAATCCCAGAAGCAGCCGCAGGAGCCCCCAACGCAGGAGTCCTCGAGCAAACCTCGTCGCAAAAAATGC
AAGCCACGCCCCTCCAAGTCTCAATCGCCAGTTGAGTCGGAGAAGAAACCTTTCACTTCGGAACCAACACCCAAG
GTCAAACCTGGTCGTAAACCGTGCAAGCCAGCACCTGGGCAGTCGCAACAGCCCGTCGGGGATCAGGAACAGCCC
GGCGAGCAGTCCTCCAGTGGCAATGACAGTGACAAACCTGCGGAGGAGAAGCCGCAGCCTCCCAAAATCGACGAT
AAGCCGGCCGAGACCACGGGGCAGCAACCAACAACTCCCCAGGAACCTCCCCAGGAACCTCCTCAGGAACCCGCT
GGAGAGCCCGAGAAGCCCGCTGCAGAGTCGGAGCAGCCCGCAGGAGAACCGGAAAAGCCGGCTGAGAAGCCCCAG
AAGCCCGCCACAGAGTCCGAGTCTGAGAAGCCCGCCGAAGAGCCCAAAAGGCCCACTGAAGAGCCCGGAAAACCC
GCCAAGCCTCAGTCACCTCAAGGCCGTCCCGGTGGGAAGATGATGGCCACGGCACACGTCCAGTACGCGTCGTCG
ATTGGCGTCCTCGGCTGCAAGGGCGTCGACCTGAGCCGTATCGCCTTCTTCCCAGGAACACCCGGCTGCGACGAC
TTCTGCGTCAAGGTCACGTACGAGGGCCGCAGCGTCAATCTCCTGCGCGTAGACAGCTCCGGAAGCGCTCCCTCG
CCGGACAACTCGGGCACTTTTGACATGTCGTGCCAGGCATACGACTTTCTCGTCCACGGCACGGACAACAAGAAC
TCGTGCAAGACGGGCGACCGCACTCCCATGAGCTACGAGACGGTCGACCCCGAAGAATGCAAGCATCTTCTTCGA
GGCGGCGTGCTGCCCATCTCGGCGCCCAATCCCAACTATTTTGTTGAGTGTGCAAACTCGCCTACTTTTAAGCAG
GGCAGTCTGAAGCTGGCCATGTTCAACATCAATGACTCGAGGTGCGAGCATGGCATTGACGAGGAGTGCTCCTGG
TCTGGTGTCGGCGATCCTACCTGTCCCAGCGGGCTTGGAGCAGGAAACCAGCGCGATCTGCCGGGTCTTCAGATC
ACGGACCCATCGTATGGTGGCTAG
Gene >Ophio5|2467
ATGCTGGTCTCCGTCGTTAGCTCCATTCTCGTCGCCTCTGGCGCTTTCGTTTCTGTCGGAGCCTTCCCGTGCAAT
GACTGCGGCAATGGCTCACTCACTTCCCACTCTGTCACCATGAATACCGTTCTTCGTGCCCTCATGTCGACCGAC
CGGAAGCGCGTCGCGGCCGGCGAGCTGTCCGAGTCGAAAGTCGCCGCCGTTCCCGAGAACCGAGTCGAAGAGAAA
CAGGAGTTCGCCAACGGGATAGGCGGCGCACCGAATGGAAAGAAAAATTGCGGCAGACCTCCTGTTCAGCCGCAA
CCGTCTGTTGTTTCTTCTCAGGCACAGGCTAGCCCTCAGGATAAGACAAGACCTCAGGGTCAGCCCTCTGAAGGT
GTTTCCGAATCCCAGAAGCAGCCGCAGGAGCCCCCAACGCAGGAGTCCTCGAGCAAACCTCGTCGCAAAAAATGC
AAGCCACGCCCCTCCAAGTCTCAATCGCCAGTTGAGTCGGAGAAGAAACCTTTCACTTCGGAACCAACACCCAAG
GTCAAACCTGGTCGTAAACCGTGCAAGCCAGCACCTGGGCAGTCGCAACAGCCCGTCGGGGATCAGGAACAGCCC
GGCGAGCAGTCCTCCAGTGGCAATGACAGTGACAAACCTGCGGAGGAGAAGCCGCAGCCTCCCAAAATCGACGAT
AAGCCGGCCGAGACCACGGGGCAGCAACCAACAACTCCCCAGGAACCTCCCCAGGAACCTCCTCAGGAACCCGCT
GGAGAGCCCGAGAAGCCCGCTGCAGAGTCGGAGCAGCCCGCAGGAGAACCGGAAAAGCCGGCTGAGAAGCCCCAG
AAGCCCGCCACAGAGTCCGAGTCTGAGAAGCCCGCCGAAGAGCCCAAAAGGCCCACTGAAGAGCCCGGAAAACCC
GCCAAGCCTCAGTCACCTCAAGGCCGTCCCGGTGGGAAGATGATGGCCACGGCACACGTCCAGTACGCGTCGTCG
ATTGGCGTCCTCGGCTGCAAGGGCGTCGACCTGAGCCGTATCGCCTTCTTCCCAGGAACACCCGGCTGCGACGAC
TTCTGCGTCAAGGTCACGTACGAGGGCCGCAGCGTCAATCTCCTGCGCGTAGACAGCTCCGGAAGCGCTCCCTCG
CCGGACAACTCGGGCACTTTTGACATGTCGTGCCAGGCATACGACTTTCTCGTCCACGGCACGGACAACAAGAAC
TCGTGCAAGACGGGCGACCGCACTCCCATGAGCTACGAGACGGTCGACCCCGAAGAATGCAAGCATCTTCTTCGA
GGCGGCGTGCTGCCCATCTCGGCGCCCAATCCCAACTATTTTGTTGAGTGTGCAAACTCGCCTACTTTTAAGCAG
GGCAGTCTGAAGCTGGCCATGTTCAACATCAATGACTCGAGGTGCGAGCATGGCATTGACGAGGAGTGCTCCTGG
TCTGGTGTCGGCGATCCTACCTGTCCCAGCGGGCTTGGAGCAGGAAACCAGCGCGATCTGCCGGGTCTTCAGATC
ACGGACCCATCGTATGGTGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail