Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2452
Gene name
Locationscaffold_203:756..2255
Strand+
Gene length (bp)1499
Transcript length (bp)1137
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 7.5E-21 312 372

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14142|SYM1_SCHPO Protein sym1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sym1 PE=3 SV=1 160 378 3.0E-49
sp|Q08743|YO292_YEAST Vacuolar membrane protein YOR292C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR292C PE=1 SV=1 145 377 9.0E-34
sp|Q10244|YD1E_SCHPO Uncharacterized protein C4G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.14 PE=3 SV=1 166 377 2.0E-33
sp|Q4WDZ0|SYM1_ASPFU Protein sym1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sym1 PE=3 SV=1 174 375 3.0E-24
sp|Q4IPX8|SYM1_GIBZE Protein SYM1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SYM1 PE=3 SV=1 168 377 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14142|SYM1_SCHPO Protein sym1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sym1 PE=3 SV=1 160 378 3.0E-49
sp|Q08743|YO292_YEAST Vacuolar membrane protein YOR292C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR292C PE=1 SV=1 145 377 9.0E-34
sp|Q10244|YD1E_SCHPO Uncharacterized protein C4G9.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.14 PE=3 SV=1 166 377 2.0E-33
sp|Q4WDZ0|SYM1_ASPFU Protein sym1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sym1 PE=3 SV=1 174 375 3.0E-24
sp|Q4IPX8|SYM1_GIBZE Protein SYM1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SYM1 PE=3 SV=1 168 377 3.0E-22
sp|Q7SCY7|SYM1_NEUCR Protein sym-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sym-1 PE=3 SV=2 175 377 2.0E-20
sp|Q6BMY0|SYM1_DEBHA Protein SYM1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SYM1 PE=3 SV=1 228 372 3.0E-20
sp|Q754F0|SYM1_ASHGO Protein SYM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SYM1 PE=3 SV=1 267 377 9.0E-20
sp|Q6CIY7|SYM1_KLULA Protein SYM1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SYM1 PE=3 SV=1 236 376 2.0E-19
sp|Q6FXJ3|SYM1_CANGA Protein SYM1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SYM1 PE=3 SV=1 246 377 8.0E-19
sp|Q59Q43|SYM1_CANAL Protein SYM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SYM1 PE=3 SV=1 167 372 3.0E-18
sp|P0CQ39|SYM1_CRYNB Protein SYM1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SYM1 PE=3 SV=1 161 377 4.0E-18
sp|P0CQ38|SYM1_CRYNJ Protein SYM1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SYM1 PE=3 SV=1 161 377 4.0E-18
sp|Q54FR4|PX24D_DICDI PXMP2/4 family protein 4 OS=Dictyostelium discoideum GN=DDB_G0290631 PE=3 SV=1 173 377 1.0E-17
sp|Q06563|SYM1_YEAST Protein SYM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYM1 PE=1 SV=1 235 377 1.0E-17
sp|Q66GV0|MPV17_XENLA Protein Mpv17 OS=Xenopus laevis GN=mpv17 PE=2 SV=2 228 372 1.0E-17
sp|Q2TXA2|SYM1_ASPOR Protein sym1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sym1 PE=3 SV=1 174 378 1.0E-17
sp|A5D787|M17L2_BOVIN Mpv17-like protein 2 OS=Bos taurus GN=MPV17L2 PE=2 SV=1 246 372 1.0E-15
sp|Q6CAW5|SYM1_YARLI Protein SYM1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SYM1 PE=3 SV=1 230 377 2.0E-15
sp|Q6DIY8|M17L2_XENTR Mpv17-like protein 2 OS=Xenopus tropicalis GN=mpv17l2 PE=2 SV=1 247 372 3.0E-15
sp|Q4P9K6|SYM1_USTMA Protein SYM1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SYM1 PE=3 SV=1 247 377 4.0E-15
sp|Q567V2|M17L2_HUMAN Mpv17-like protein 2 OS=Homo sapiens GN=MPV17L2 PE=1 SV=2 246 372 6.0E-15
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 247 373 2.0E-14
sp|Q2KIY1|PXMP2_BOVIN Peroxisomal membrane protein 2 OS=Bos taurus GN=PXMP2 PE=2 SV=3 176 372 3.0E-14
sp|Q5BK62|MPV17_RAT Protein Mpv17 OS=Rattus norvegicus GN=Mpv17 PE=2 SV=1 255 372 5.0E-14
sp|Q6DGV7|M17L2_DANRE Mpv17-like protein 2 OS=Danio rerio GN=mpv17l2 PE=2 SV=1 247 378 1.0E-13
sp|Q9V492|MPV17_DROME Mpv17-like protein OS=Drosophila melanogaster GN=CG11077 PE=2 SV=1 238 373 1.0E-13
sp|P19258|MPV17_MOUSE Protein Mpv17 OS=Mus musculus GN=Mpv17 PE=1 SV=1 255 372 1.0E-13
sp|Q68F62|MP17L_XENLA Mpv17-like protein OS=Xenopus laevis GN=mpv17l PE=2 SV=1 239 378 2.0E-13
sp|Q2KIN6|MPV17_BOVIN Protein Mpv17 OS=Bos taurus GN=MPV17 PE=2 SV=1 255 372 3.0E-13
sp|P39210|MPV17_HUMAN Protein Mpv17 OS=Homo sapiens GN=MPV17 PE=1 SV=1 255 372 3.0E-13
sp|Q8VIK2|M17L2_MOUSE Mpv17-like protein 2 OS=Mus musculus GN=Mpv17l2 PE=1 SV=1 246 372 1.0E-12
sp|Q07066|PXMP2_RAT Peroxisomal membrane protein 2 OS=Rattus norvegicus GN=Pxmp2 PE=1 SV=2 163 372 2.0E-12
sp|P42925|PXMP2_MOUSE Peroxisomal membrane protein 2 OS=Mus musculus GN=Pxmp2 PE=1 SV=2 231 372 5.0E-12
sp|Q60SZ2|MPV17_CAEBR Mpv17-like protein (Fragment) OS=Caenorhabditis briggsae GN=CBG20693 PE=3 SV=2 246 373 6.0E-12
sp|Q5TZ51|MPV17_DANRE Protein Mpv17 OS=Danio rerio GN=mpv17 PE=2 SV=1 250 372 2.0E-11
sp|Q2QL34|MP17L_HUMAN Mpv17-like protein OS=Homo sapiens GN=MPV17L PE=1 SV=1 262 377 7.0E-11
sp|Q54XX9|PX24B_DICDI PXMP2/4 family protein 2 OS=Dictyostelium discoideum GN=DDB_G0278529 PE=3 SV=1 173 372 9.0E-11
sp|Q99MS3|MP17L_MOUSE Mpv17-like protein OS=Mus musculus GN=Mpv17l PE=1 SV=2 264 377 3.0E-09
sp|Q2KIK2|MP17L_BOVIN Mpv17-like protein OS=Bos taurus GN=MPV17L PE=2 SV=1 262 375 1.0E-08
sp|Q9NR77|PXMP2_HUMAN Peroxisomal membrane protein 2 OS=Homo sapiens GN=PXMP2 PE=1 SV=3 253 372 5.0E-08
sp|Q7YWV6|MPV17_CAEEL Mpv17-like protein OS=Caenorhabditis elegans GN=T18D3.9 PE=3 SV=1 234 372 9.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 109 128 19
2 141 163 22
3 178 200 22
4 296 313 17
5 352 374 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 146.23 79.63 212.84
CcL In ants, during behavior modification 95.34 51.65 139.03
CcD In ants, recently dead 84.33 46.58 122.07

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.056311 no
SC16a CcD 0.009968 yes
CcL CcD 0.634700 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2452
MVSALVVRTVRALLVIPSLGRFGTPAVPCHLVTTLPFNQHITIVFAAFISALSALHRRLLPTPPPPPPSPPTPDS
ITNSLSGYAPLPLPSGPDDRALPPPRARPQRSRALISVVIALCLIAVIMSWELSRRRISRAVNSQYIFGRIPLLH
AIIFLVEMALVARLTARFNTYYEERPLMTMMVTNAILGGIADTVAQGITAVQRATRKAAGSTKDDDFSFEIDEIG
RKGTFLDRDLLPDSKALPPPFDFERLTRFMAYGFCVAPLQFKWFRFLERAFPMTKTSAFGPAMKRVVFDQFVYAP
FGVGLFFVVMTVAEGGGKRAVSNKLRDMYVPTLKANYVVWPAVQMVNFRLMPVQYQLPFVSTIGIAWTAYLSLTN
ASD
Coding >Ophio5|2452
ATGGTATCGGCTTTGGTCGTGCGCACAGTGCGTGCTCTGCTCGTGATTCCCTCTCTAGGTCGTTTCGGAACCCCT
GCTGTTCCCTGCCACCTCGTCACCACGCTGCCTTTCAATCAGCACATCACCATCGTCTTTGCGGCATTCATCTCG
GCCTTGTCCGCTCTTCACCGTCGCCTCCTACCGACTCCTCCGCCGCCACCGCCGTCGCCTCCTACTCCGGACTCG
ATCACAAACTCGCTCTCCGGCTACGCGCCGCTTCCCCTCCCCTCCGGTCCGGACGACCGCGCCCTTCCTCCTCCT
CGAGCTCGTCCGCAGAGATCCCGAGCGCTCATCAGTGTCGTCATCGCGCTCTGTCTCATCGCCGTCATCATGTCC
TGGGAGCTGTCGAGGCGGCGCATCTCGCGCGCCGTCAACAGTCAGTATATCTTCGGTCGCATCCCGTTACTGCAC
GCCATCATCTTTCTCGTCGAAATGGCTCTCGTCGCCCGTCTGACGGCTAGGTTCAATACCTACTACGAAGAGCGA
CCACTCATGACCATGATGGTGACCAATGCCATACTCGGTGGCATCGCCGACACCGTCGCCCAGGGCATCACCGCC
GTCCAGCGTGCGACTCGCAAGGCAGCCGGCTCCACCAAGGACGACGACTTCTCCTTTGAGATCGACGAGATTGGC
CGCAAGGGAACCTTTCTCGATCGAGACCTGCTGCCCGACTCAAAGGCGCTCCCGCCGCCGTTCGACTTTGAGCGG
CTGACGCGCTTCATGGCCTATGGTTTCTGCGTTGCGCCGCTGCAGTTCAAGTGGTTTCGTTTCCTTGAGCGTGCC
TTTCCCATGACCAAGACGAGTGCTTTCGGTCCGGCCATGAAGCGCGTCGTCTTCGACCAGTTCGTCTATGCGCCT
TTCGGTGTCGGCCTATTTTTCGTCGTCATGACTGTTGCCGAGGGAGGCGGCAAACGTGCCGTCAGCAACAAGTTG
AGGGACATGTATGTCCCGACGCTCAAGGCCAACTACGTCGTCTGGCCGGCTGTCCAGATGGTCAACTTTCGCCTG
ATGCCGGTTCAGTACCAGCTGCCCTTTGTGTCGACAATCGGTATTGCCTGGACGGCCTACCTATCCCTCACCAAC
GCATCCGAC
Transcript >Ophio5|2452
ATGGTATCGGCTTTGGTCGTGCGCACAGTGCGTGCTCTGCTCGTGATTCCCTCTCTAGGTCGTTTCGGAACCCCT
GCTGTTCCCTGCCACCTCGTCACCACGCTGCCTTTCAATCAGCACATCACCATCGTCTTTGCGGCATTCATCTCG
GCCTTGTCCGCTCTTCACCGTCGCCTCCTACCGACTCCTCCGCCGCCACCGCCGTCGCCTCCTACTCCGGACTCG
ATCACAAACTCGCTCTCCGGCTACGCGCCGCTTCCCCTCCCCTCCGGTCCGGACGACCGCGCCCTTCCTCCTCCT
CGAGCTCGTCCGCAGAGATCCCGAGCGCTCATCAGTGTCGTCATCGCGCTCTGTCTCATCGCCGTCATCATGTCC
TGGGAGCTGTCGAGGCGGCGCATCTCGCGCGCCGTCAACAGTCAGTATATCTTCGGTCGCATCCCGTTACTGCAC
GCCATCATCTTTCTCGTCGAAATGGCTCTCGTCGCCCGTCTGACGGCTAGGTTCAATACCTACTACGAAGAGCGA
CCACTCATGACCATGATGGTGACCAATGCCATACTCGGTGGCATCGCCGACACCGTCGCCCAGGGCATCACCGCC
GTCCAGCGTGCGACTCGCAAGGCAGCCGGCTCCACCAAGGACGACGACTTCTCCTTTGAGATCGACGAGATTGGC
CGCAAGGGAACCTTTCTCGATCGAGACCTGCTGCCCGACTCAAAGGCGCTCCCGCCGCCGTTCGACTTTGAGCGG
CTGACGCGCTTCATGGCCTATGGTTTCTGCGTTGCGCCGCTGCAGTTCAAGTGGTTTCGTTTCCTTGAGCGTGCC
TTTCCCATGACCAAGACGAGTGCTTTCGGTCCGGCCATGAAGCGCGTCGTCTTCGACCAGTTCGTCTATGCGCCT
TTCGGTGTCGGCCTATTTTTCGTCGTCATGACTGTTGCCGAGGGAGGCGGCAAACGTGCCGTCAGCAACAAGTTG
AGGGACATGTATGTCCCGACGCTCAAGGCCAACTACGTCGTCTGGCCGGCTGTCCAGATGGTCAACTTTCGCCTG
ATGCCGGTTCAGTACCAGCTGCCCTTTGTGTCGACAATCGGTATTGCCTGGACGGCCTACCTATCCCTCACCAAC
GCATCCGACTAG
Gene >Ophio5|2452
ATGGTATCGGCTTTGGTCGTGCGCACAGTGCGTGCTCTGCTCGTGATTCCCTCTCTAGGTCGTTTCGGAACCCCT
GCTGTTCCCTGCCACCTCGTCACCACGCTGCCTTTCAATCAGCACATCACCATCGTCTTTGCGGCATTCATCTCG
GCCTTGTCCGCTCTTCACCGTCGCCTCCTACCGACTCCTCCGCCGCCACCGCCGTCGCCTCCTACTCCGGACTCG
ATCACAAACTCGCTCTCCGGCTACGCGCCGCTTCCCCTCCCCTCCGGTCCGGACGACCGCGCCCTTCCTCCTCCT
CGAGCTCGTCCGCAGAGATCCCGAGCGCTCATCAGTGTCGTCATCGCGCTCTGTCTCATCGCCGTCATCATGTCC
TGGGAGCTGTCGAGGCGGCGCATCTCGCGCGCCGTCAACAGTCAGTATATCTTCGGTCGCATCGTATGTCACTAC
CTACCTAGCTGCTCCACCCCGGTGTTCCCTACTTCCTTCCCTACCTACTTTTTTTGCGTCTTTGTAATTTCACCT
TTTTTTTATTTTCTTTTCTTTGTCTTTCGCCTCAGCAGTTGCCACCTTGTCAACATACCAGGACATCCACTGACG
ACACGCATAGCCGTTACTGCACGCCATCATCTTTCTCGTCGAAATGGCTCTCGTCGCCCGTCTGACGGCTAGGTT
CAATACCTACTACGAAGAGCGACCACGTACGTACCTGCCTCGATGCTGTTATGGCCATTCCCCCCTCAATTTTTG
AGATGGGGGAGGAATCAACCAAGCAGCTGCAAATTATGCACGTCCAAAACACGCGCAGATGAGGTGACTGACTCG
CGTCACCAACAGTCATGACCATGATGGTGACCAATGCCATACTCGGTGGCATCGCCGACACCGTCGCCCAGGGCA
TCACCGCCGTCCAGCGTGCGACTCGCAAGGCAGCCGGCTCCACCAAGGACGACGACTTCTCCTTTGAGATCGACG
AGATTGGCCGCAAGGGAACCTTTCTCGATCGAGACCTGCTGCCCGACTCAAAGGCGCTCCCGCCGCCGTTCGACT
TTGAGCGGCTGACGCGCTTCATGGCCTATGGTTTCTGCGTTGCGCCGCTGCAGTTCAAGTGGTTTCGTTTCCTTG
AGCGTGCCTTTCCCATGACCAAGACGAGTGCTTTCGGTCCGGCCATGAAGCGCGTCGTCTTCGACCAGTTCGTCT
ATGCGCCTTTCGGTGTCGGCCTATTTTTCGTCGTCATGACTGTTGCCGAGGGAGGCGGCAAACGTGCCGTCAGCA
ACAAGTTGAGGGACATGTATGTCCCGACGCTCAAGGCCAACTACGTCGTCTGGCCGGCTGTCCAGATGGTCAACT
TTCGCCTGATGCCGGTTCAGTACCAGCTGGTATGTCAACCACGAGCCATTGATTTCGTTGGTTTTCATGGGCTAA
CCGAGCAGCCCTTTGTGTCGACAATCGGTATTGCCTGGACGGCCTACCTATCCCTCACCAACGCATCCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail