Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2448
Gene name
Locationscaffold_202:23009..24460
Strand-
Gene length (bp)1451
Transcript length (bp)1332
Coding sequence length (bp)1329
Protein length (aa) 443

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05631 MFS_5 Sugar-tranasporters, 12 TM 1.4E-57 37 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6DG19|MFSD5_DANRE Molybdate-anion transporter OS=Danio rerio GN=mfsd5 PE=2 SV=1 8 393 7.0E-40
sp|Q1KKV8|MFSD5_TAKRU Molybdate-anion transporter OS=Takifugu rubripes GN=mfsd5 PE=3 SV=1 3 393 4.0E-37
sp|Q6N075|MFSD5_HUMAN Molybdate-anion transporter OS=Homo sapiens GN=MFSD5 PE=1 SV=2 32 415 2.0E-34
sp|Q0VC03|MFSD5_BOVIN Molybdate-anion transporter OS=Bos taurus GN=MFSD5 PE=2 SV=1 43 393 7.0E-34
sp|Q921Y4|MFSD5_MOUSE Molybdate-anion transporter OS=Mus musculus GN=Mfsd5 PE=2 SV=1 32 393 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6DG19|MFSD5_DANRE Molybdate-anion transporter OS=Danio rerio GN=mfsd5 PE=2 SV=1 8 393 7.0E-40
sp|Q1KKV8|MFSD5_TAKRU Molybdate-anion transporter OS=Takifugu rubripes GN=mfsd5 PE=3 SV=1 3 393 4.0E-37
sp|Q6N075|MFSD5_HUMAN Molybdate-anion transporter OS=Homo sapiens GN=MFSD5 PE=1 SV=2 32 415 2.0E-34
sp|Q0VC03|MFSD5_BOVIN Molybdate-anion transporter OS=Bos taurus GN=MFSD5 PE=2 SV=1 43 393 7.0E-34
sp|Q921Y4|MFSD5_MOUSE Molybdate-anion transporter OS=Mus musculus GN=Mfsd5 PE=2 SV=1 32 393 2.0E-33
sp|Q5R542|MFSD5_PONAB Molybdate-anion transporter OS=Pongo abelii GN=MFSD5 PE=2 SV=1 32 393 7.0E-32
sp|Q08B29|MFSD5_XENLA Molybdate-anion transporter OS=Xenopus laevis GN=mfsd5 PE=2 SV=1 34 393 3.0E-31
sp|Q28E13|MFSD5_XENTR Molybdate-anion transporter OS=Xenopus tropicalis GN=mfsd5 PE=2 SV=1 34 393 4.0E-30
[Show less]

GO

GO Term Description Terminal node
GO:0015689 molybdate ion transport Yes
GO:0015098 molybdate ion transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0022857 transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006820 anion transport No
GO:0005575 cellular_component No
GO:0015698 inorganic anion transport No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 4 21 17
2 48 70 22
3 80 102 22
4 135 157 22
5 202 224 22
6 258 280 22
7 295 317 22
8 329 347 18
9 352 373 21
10 413 435 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2448
MDFYVTNLAALCALNAILLYRRHRRRGPQLAPFNAARRETARKFQQRFLAPYALAVAADWLQGPHLYALYKSEKQ
LPEDVVALLYATGFVSAAVSATVAGQLVDRLGRRSACQYYCIFNSFSCGLVLYRSMPLLILGRVSGGIATTLLFS
AFESWMISEYHLLGLDDSVLPLKTVLENMTLVNSAVAMLSGVAGDALVEASGMRVTPFVVANLCCLVAARLLLFL
WRENSRGGPVVKGQWTDYWLGIVTVLTSKRISALAMATCFFEGAMYLFVFFWTAALKSVRLRAGIDKEPPLGLIF
SSFMCAMMAGSLVSAPLRAPSRQSATTDLCVAMAIGSGSLSCAVLFGDERKLFWAFCVLEATVGAYFPAMGFLKS
EFVDDDRRGHVYSALRLPLNLFVLIGHSLDKEGDEHRVSVFLTLAGFLAAASVVVQRSLARSGGDGAA
Coding >Ophio5|2448
ATGGACTTTTACGTGACAAACCTTGCGGCACTATGCGCGCTCAACGCGATCCTCCTCTATCGAAGACACCGACGT
CGAGGTCCGCAGCTGGCTCCGTTCAATGCCGCGCGTCGGGAGACGGCTCGAAAATTTCAGCAACGCTTTCTCGCT
CCATATGCCCTTGCCGTCGCAGCCGACTGGTTGCAGGGACCGCACCTGTACGCCTTGTACAAGAGTGAGAAACAA
CTCCCAGAAGACGTCGTTGCGCTTCTCTATGCCACCGGCTTCGTGTCGGCAGCCGTGAGCGCGACGGTCGCTGGG
CAGCTGGTTGATCGCCTCGGCAGACGGTCCGCATGCCAGTACTACTGCATCTTCAATAGCTTTTCCTGTGGCCTG
GTGCTCTACAGGAGCATGCCCCTCCTCATACTGGGTCGAGTCTCGGGCGGTATCGCCACGACTCTCCTCTTCAGC
GCCTTTGAATCGTGGATGATCTCCGAGTACCACTTGTTGGGGCTCGACGATTCGGTGCTGCCTCTCAAGACGGTG
CTGGAGAACATGACACTCGTCAACAGCGCCGTGGCCATGCTTTCGGGCGTTGCGGGCGATGCACTAGTCGAAGCG
TCTGGCATGCGAGTCACGCCCTTTGTAGTCGCCAATCTGTGCTGTCTGGTAGCTGCCCGCCTGCTACTGTTTTTG
TGGCGTGAAAACAGCCGCGGCGGCCCCGTCGTCAAGGGCCAATGGACGGACTACTGGCTCGGGATCGTGACGGTG
TTGACCAGCAAGAGGATCTCGGCTCTGGCCATGGCCACATGCTTCTTTGAAGGAGCCATGTACCTCTTCGTCTTT
TTCTGGACCGCGGCACTCAAGAGCGTTCGTCTCAGGGCCGGCATCGACAAGGAGCCTCCGCTGGGACTCATCTTC
TCGAGCTTCATGTGCGCCATGATGGCCGGTTCGCTCGTCTCGGCTCCGCTCAGGGCCCCGTCGCGACAGAGCGCA
ACGACGGATCTGTGTGTGGCCATGGCCATCGGCAGCGGGAGCCTGTCGTGCGCCGTGCTCTTCGGCGACGAGAGG
AAGCTGTTCTGGGCGTTTTGCGTCCTGGAGGCGACCGTCGGCGCCTATTTTCCCGCCATGGGCTTTCTGAAGAGC
GAGTTTGTCGACGACGACAGGCGAGGCCACGTGTATAGCGCCCTCCGACTACCGTTGAACCTGTTCGTCCTAATC
GGCCACAGCCTGGACAAAGAGGGTGACGAGCACAGGGTCAGCGTGTTTCTGACGCTCGCGGGGTTTTTGGCCGCG
GCTTCGGTCGTAGTGCAGCGCAGTCTGGCCCGAAGCGGTGGGGACGGGGCGGCT
Transcript >Ophio5|2448
ATGGACTTTTACGTGACAAACCTTGCGGCACTATGCGCGCTCAACGCGATCCTCCTCTATCGAAGACACCGACGT
CGAGGTCCGCAGCTGGCTCCGTTCAATGCCGCGCGTCGGGAGACGGCTCGAAAATTTCAGCAACGCTTTCTCGCT
CCATATGCCCTTGCCGTCGCAGCCGACTGGTTGCAGGGACCGCACCTGTACGCCTTGTACAAGAGTGAGAAACAA
CTCCCAGAAGACGTCGTTGCGCTTCTCTATGCCACCGGCTTCGTGTCGGCAGCCGTGAGCGCGACGGTCGCTGGG
CAGCTGGTTGATCGCCTCGGCAGACGGTCCGCATGCCAGTACTACTGCATCTTCAATAGCTTTTCCTGTGGCCTG
GTGCTCTACAGGAGCATGCCCCTCCTCATACTGGGTCGAGTCTCGGGCGGTATCGCCACGACTCTCCTCTTCAGC
GCCTTTGAATCGTGGATGATCTCCGAGTACCACTTGTTGGGGCTCGACGATTCGGTGCTGCCTCTCAAGACGGTG
CTGGAGAACATGACACTCGTCAACAGCGCCGTGGCCATGCTTTCGGGCGTTGCGGGCGATGCACTAGTCGAAGCG
TCTGGCATGCGAGTCACGCCCTTTGTAGTCGCCAATCTGTGCTGTCTGGTAGCTGCCCGCCTGCTACTGTTTTTG
TGGCGTGAAAACAGCCGCGGCGGCCCCGTCGTCAAGGGCCAATGGACGGACTACTGGCTCGGGATCGTGACGGTG
TTGACCAGCAAGAGGATCTCGGCTCTGGCCATGGCCACATGCTTCTTTGAAGGAGCCATGTACCTCTTCGTCTTT
TTCTGGACCGCGGCACTCAAGAGCGTTCGTCTCAGGGCCGGCATCGACAAGGAGCCTCCGCTGGGACTCATCTTC
TCGAGCTTCATGTGCGCCATGATGGCCGGTTCGCTCGTCTCGGCTCCGCTCAGGGCCCCGTCGCGACAGAGCGCA
ACGACGGATCTGTGTGTGGCCATGGCCATCGGCAGCGGGAGCCTGTCGTGCGCCGTGCTCTTCGGCGACGAGAGG
AAGCTGTTCTGGGCGTTTTGCGTCCTGGAGGCGACCGTCGGCGCCTATTTTCCCGCCATGGGCTTTCTGAAGAGC
GAGTTTGTCGACGACGACAGGCGAGGCCACGTGTATAGCGCCCTCCGACTACCGTTGAACCTGTTCGTCCTAATC
GGCCACAGCCTGGACAAAGAGGGTGACGAGCACAGGGTCAGCGTGTTTCTGACGCTCGCGGGGTTTTTGGCCGCG
GCTTCGGTCGTAGTGCAGCGCAGTCTGGCCCGAAGCGGTGGGGACGGGGCGGCTTAG
Gene >Ophio5|2448
ATGGACTTTTACGTGACAAACCTTGCGGCACTATGCGCGCTCAACGCGATCCTCCTCTATCGAAGACACCGACGT
CGAGGTCCGCAGCTGGCTCCGTTCAATGCCGCGCGTCGGGAGACGGCTCGAAAATTTCAGCAACGCTTTCTCGCT
CCATATGCCCTTGCCGTCGCAGCCGACTGGTTGCAGGCCAGTCTTCTCCTCCCGCGGCGTCGGTTTAATAAACCA
CCGGCTGACTCGACGGGCTCCAGGGACCGCACCTGTACGCCTTGTACAAGAGTGAGAAACAACTCCCAGAAGACG
TCGTTGCGCTTCTCTATGCCACCGGCTTCGTGTCGGCAGCCGTGAGCGCGACGGTCGCTGGGCAGCTGGTTGATC
GCCTCGGCAGACGGTCCGCATGCCAGTACTACTGCATCTTCAATAGCTTTTCCTGTGGCCTGGTGCTCTACAGGA
GCATGCCCCTCCTCATACTGGGTCGAGTCTCGGGCGGTATCGCCACGACTCTCCTCTTCAGCGCCTTTGAATCGT
GGATGATCTCCGAGTACCACTTGTTGGGGCTCGACGATTCGGTGCTGCCTCTCAAGACGGTGCTGGAGAACATGA
CACTCGTCAACAGCGCCGTGGCCATGCTTTCGGGCGTTGCGGGCGATGCACTAGTCGAAGCGTCTGGCATGCGAG
TCACGCCCTTTGTAGTCGCCAATCTGTGCTGTCTGGTAGCTGCCCGCCTGCTACTGTTTTTGTGGCGTGAAAACA
GCCGCGGCGGCCCCGTCGTCAAGGGCCAATGGACGGACTACTGGCTCGGGATCGTGACGGTGTTGACCAGCAAGA
GGATCTCGGCTCTGGCCATGGCCACATGCTTCTTTGAAGGAGCCATGTACCTCTTCGTCTTTTTCTGGACCGCGG
CACTCAAGAGCGTTCGTCTCAGGGCCGGCATCGACAAGGAGCCTCCGCTGGGACTCATCTTCTCGAGCTTCATGT
GCGCCATGATGGCCGGTTCGCTCGTCTCGGCTCCGCTCAGGGCCCCGTCGCGACAGAGCGCAACGACGGATCTGT
GTGTGGCCATGGCCATCGGCAGCGGGAGCCTGTCGTGCGCCGTGCTCTTCGGCGACGAGAGGAAGCTGTTCTGGG
CGTTTTGCGTCCTGGAGGCGACCGTCGGCGCCTATTTTCCCGCCATGGGCTTTCTGAAGAGCGAGTTTGTCGACG
ACGACAGGCGAGGCCACGTGTATAGCGCCCTCCGACTACCGTTGAACCTGTTCGTCCTAATCGGCCACAGCCTGG
ACAAAGAGGGTCGGTGACACCATGGTTTGACCACCCTTGGAGCGAAGCTGACTCGAGACTGTGCAGGTGACGAGC
ACAGGGTCAGCGTGTTTCTGACGCTCGCGGGGTTTTTGGCCGCGGCTTCGGTCGTAGTGCAGCGCAGTCTGGCCC
GAAGCGGTGGGGACGGGGCGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail