Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2446
Gene name
Locationscaffold_202:18445..19492
Strand+
Gene length (bp)1047
Transcript length (bp)1047
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 1.2E-07 124 212

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NHD5|SAN_DROME Probable N-acetyltransferase san OS=Drosophila melanogaster GN=san PE=1 SV=1 89 250 8.0E-18
sp|Q6GP53|NAA50_XENLA N-alpha-acetyltransferase 50 OS=Xenopus laevis GN=naa50 PE=2 SV=1 85 243 9.0E-17
sp|Q6DBY2|NAA50_DANRE N-alpha-acetyltransferase 50 OS=Danio rerio GN=naa50 PE=1 SV=1 85 244 1.0E-16
sp|Q5XGA9|NAA50_XENTR N-alpha-acetyltransferase 50 OS=Xenopus tropicalis GN=naa50 PE=2 SV=1 85 243 1.0E-16
sp|Q9P6R8|CWC24_SCHPO Pre-mRNA-splicing factor cwf24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf24 PE=1 SV=1 57 234 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NHD5|SAN_DROME Probable N-acetyltransferase san OS=Drosophila melanogaster GN=san PE=1 SV=1 89 250 8.0E-18
sp|Q6GP53|NAA50_XENLA N-alpha-acetyltransferase 50 OS=Xenopus laevis GN=naa50 PE=2 SV=1 85 243 9.0E-17
sp|Q6DBY2|NAA50_DANRE N-alpha-acetyltransferase 50 OS=Danio rerio GN=naa50 PE=1 SV=1 85 244 1.0E-16
sp|Q5XGA9|NAA50_XENTR N-alpha-acetyltransferase 50 OS=Xenopus tropicalis GN=naa50 PE=2 SV=1 85 243 1.0E-16
sp|Q9P6R8|CWC24_SCHPO Pre-mRNA-splicing factor cwf24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf24 PE=1 SV=1 57 234 3.0E-16
sp|Q6PGB6|NAA50_MOUSE N-alpha-acetyltransferase 50 OS=Mus musculus GN=Naa50 PE=1 SV=1 85 239 8.0E-16
sp|Q5RF28|NAA50_PONAB N-alpha-acetyltransferase 50 OS=Pongo abelii GN=NAA50 PE=2 SV=1 85 239 1.0E-15
sp|Q9GZZ1|NAA50_HUMAN N-alpha-acetyltransferase 50 OS=Homo sapiens GN=NAA50 PE=1 SV=1 85 239 1.0E-15
sp|Q0IIJ0|NAA50_BOVIN N-alpha-acetyltransferase 50 OS=Bos taurus GN=NAA50 PE=2 SV=1 85 239 1.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0008080 N-acetyltransferase activity Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0016746 acyltransferase activity No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0016410 N-acyltransferase activity No
GO:0003674 molecular_function No
GO:0016407 acetyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2446
MSLPSAKAPAAQLSIRSFFPSKTIVASPPLSRVGKQPPPPPPPPPPVSSPAVASPLPTPSVDAPLPSLPTGLPSE
AVIRPISETDTAALRRINALLLPVNYPESFYARAVGRAQSGRFSRIVTWAHQGEEPKVVGGLVCRLESDDEVGNG
QRLYIQSLCLLAPYRGKGLMTAALDHIIATARSDLALDVRSVTAHVWTDNEDGLRWYQSRGFDRREQPVAGYYLK
LRPDSAWLVRRRLPSSGPPKMKTGSPLAKGDTAITNLPASRPPPSRSSASTPALPSTTTTTTTSAQSYQNQRPET
EWNDLPADMAPDLLAPPRSDPSSRAGSRSSSAARKKKDRSYPAAAFGS
Coding >Ophio5|2446
ATGTCCCTACCGTCTGCTAAGGCCCCCGCGGCCCAGCTCTCGATCCGGTCGTTTTTCCCCTCCAAGACCATCGTC
GCTTCTCCGCCGTTGTCGCGCGTCGGCAAACAACCTCCGCCTCCTCCTCCTCCTCCGCCCCCGGTCTCGTCCCCC
GCCGTCGCTTCTCCCCTGCCGACACCCAGCGTCGACGCGCCTCTTCCTTCGCTCCCGACCGGCCTCCCAAGCGAA
GCCGTGATACGACCCATCTCCGAGACCGACACGGCTGCCCTGCGTCGCATCAACGCCCTGCTGCTGCCGGTAAAC
TACCCCGAGTCCTTTTATGCGCGTGCCGTCGGCCGAGCCCAGTCCGGTCGCTTCTCTCGTATCGTCACCTGGGCG
CATCAGGGCGAGGAGCCCAAGGTTGTCGGCGGCCTTGTCTGCCGTCTCGAGTCGGATGATGAGGTCGGCAATGGT
CAGAGGTTGTATATCCAGTCGCTGTGTCTCCTCGCGCCCTATCGAGGAAAGGGCCTGATGACGGCTGCGCTCGAT
CACATCATCGCTACGGCCCGGTCCGATCTCGCCCTCGACGTCCGCTCCGTCACGGCGCACGTGTGGACAGACAAC
GAAGACGGTCTACGCTGGTACCAATCTCGCGGCTTTGACCGACGCGAACAACCCGTCGCCGGCTACTACCTCAAG
CTGCGCCCGGACTCGGCCTGGCTGGTCCGCCGTCGGCTTCCCTCGTCGGGCCCGCCAAAGATGAAGACCGGAAGC
CCCCTCGCGAAAGGCGACACCGCCATCACCAACCTCCCCGCCTCGCGCCCTCCGCCGTCGCGAAGCAGCGCTAGC
ACCCCAGCCTTGCCATCCACCACCACCACCACCACCACCAGCGCACAGTCCTACCAGAACCAGCGTCCCGAGACC
GAATGGAACGACCTCCCCGCCGACATGGCTCCAGACCTCCTCGCCCCGCCTCGCAGCGACCCTTCGTCCCGCGCC
GGCTCGAGGAGCAGCTCGGCGGCGAGAAAGAAGAAGGATCGGTCGTACCCTGCCGCCGCGTTTGGCAGC
Transcript >Ophio5|2446
ATGTCCCTACCGTCTGCTAAGGCCCCCGCGGCCCAGCTCTCGATCCGGTCGTTTTTCCCCTCCAAGACCATCGTC
GCTTCTCCGCCGTTGTCGCGCGTCGGCAAACAACCTCCGCCTCCTCCTCCTCCTCCGCCCCCGGTCTCGTCCCCC
GCCGTCGCTTCTCCCCTGCCGACACCCAGCGTCGACGCGCCTCTTCCTTCGCTCCCGACCGGCCTCCCAAGCGAA
GCCGTGATACGACCCATCTCCGAGACCGACACGGCTGCCCTGCGTCGCATCAACGCCCTGCTGCTGCCGGTAAAC
TACCCCGAGTCCTTTTATGCGCGTGCCGTCGGCCGAGCCCAGTCCGGTCGCTTCTCTCGTATCGTCACCTGGGCG
CATCAGGGCGAGGAGCCCAAGGTTGTCGGCGGCCTTGTCTGCCGTCTCGAGTCGGATGATGAGGTCGGCAATGGT
CAGAGGTTGTATATCCAGTCGCTGTGTCTCCTCGCGCCCTATCGAGGAAAGGGCCTGATGACGGCTGCGCTCGAT
CACATCATCGCTACGGCCCGGTCCGATCTCGCCCTCGACGTCCGCTCCGTCACGGCGCACGTGTGGACAGACAAC
GAAGACGGTCTACGCTGGTACCAATCTCGCGGCTTTGACCGACGCGAACAACCCGTCGCCGGCTACTACCTCAAG
CTGCGCCCGGACTCGGCCTGGCTGGTCCGCCGTCGGCTTCCCTCGTCGGGCCCGCCAAAGATGAAGACCGGAAGC
CCCCTCGCGAAAGGCGACACCGCCATCACCAACCTCCCCGCCTCGCGCCCTCCGCCGTCGCGAAGCAGCGCTAGC
ACCCCAGCCTTGCCATCCACCACCACCACCACCACCACCAGCGCACAGTCCTACCAGAACCAGCGTCCCGAGACC
GAATGGAACGACCTCCCCGCCGACATGGCTCCAGACCTCCTCGCCCCGCCTCGCAGCGACCCTTCGTCCCGCGCC
GGCTCGAGGAGCAGCTCGGCGGCGAGAAAGAAGAAGGATCGGTCGTACCCTGCCGCCGCGTTTGGCAGCTGA
Gene >Ophio5|2446
ATGTCCCTACCGTCTGCTAAGGCCCCCGCGGCCCAGCTCTCGATCCGGTCGTTTTTCCCCTCCAAGACCATCGTC
GCTTCTCCGCCGTTGTCGCGCGTCGGCAAACAACCTCCGCCTCCTCCTCCTCCTCCGCCCCCGGTCTCGTCCCCC
GCCGTCGCTTCTCCCCTGCCGACACCCAGCGTCGACGCGCCTCTTCCTTCGCTCCCGACCGGCCTCCCAAGCGAA
GCCGTGATACGACCCATCTCCGAGACCGACACGGCTGCCCTGCGTCGCATCAACGCCCTGCTGCTGCCGGTAAAC
TACCCCGAGTCCTTTTATGCGCGTGCCGTCGGCCGAGCCCAGTCCGGTCGCTTCTCTCGTATCGTCACCTGGGCG
CATCAGGGCGAGGAGCCCAAGGTTGTCGGCGGCCTTGTCTGCCGTCTCGAGTCGGATGATGAGGTCGGCAATGGT
CAGAGGTTGTATATCCAGTCGCTGTGTCTCCTCGCGCCCTATCGAGGAAAGGGCCTGATGACGGCTGCGCTCGAT
CACATCATCGCTACGGCCCGGTCCGATCTCGCCCTCGACGTCCGCTCCGTCACGGCGCACGTGTGGACAGACAAC
GAAGACGGTCTACGCTGGTACCAATCTCGCGGCTTTGACCGACGCGAACAACCCGTCGCCGGCTACTACCTCAAG
CTGCGCCCGGACTCGGCCTGGCTGGTCCGCCGTCGGCTTCCCTCGTCGGGCCCGCCAAAGATGAAGACCGGAAGC
CCCCTCGCGAAAGGCGACACCGCCATCACCAACCTCCCCGCCTCGCGCCCTCCGCCGTCGCGAAGCAGCGCTAGC
ACCCCAGCCTTGCCATCCACCACCACCACCACCACCACCAGCGCACAGTCCTACCAGAACCAGCGTCCCGAGACC
GAATGGAACGACCTCCCCGCCGACATGGCTCCAGACCTCCTCGCCCCGCCTCGCAGCGACCCTTCGTCCCGCGCC
GGCTCGAGGAGCAGCTCGGCGGCGAGAAAGAAGAAGGATCGGTCGTACCCTGCCGCCGCGTTTGGCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail