Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2443
Gene name
Locationscaffold_202:12590..14447
Strand-
Gene length (bp)1857
Transcript length (bp)1785
Coding sequence length (bp)1782
Protein length (aa) 594

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04258 Peptidase_A22B Signal peptide peptidase 1.9E-33 77 361
PF04258 Peptidase_A22B Signal peptide peptidase 6.6E-19 432 495

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49049|IMP2_CAEEL Intramembrane protease 2 OS=Caenorhabditis elegans GN=imp-2 PE=1 SV=1 247 501 3.0E-22
sp|P34248|YKK0_YEAST Probable intramembrane protease YKL100C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL100C PE=1 SV=1 225 556 8.0E-20
sp|Q6ZGL9|SIP1_ORYSJ Signal peptide peptidase 1 OS=Oryza sativa subsp. japonica GN=SPP1 PE=2 SV=1 226 357 1.0E-18
sp|O81062|SIP_ARATH Signal peptide peptidase OS=Arabidopsis thaliana GN=SPP PE=2 SV=1 260 357 2.0E-17
sp|B9FJ61|SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica GN=SPP2 PE=2 SV=1 267 357 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49049|IMP2_CAEEL Intramembrane protease 2 OS=Caenorhabditis elegans GN=imp-2 PE=1 SV=1 247 501 3.0E-22
sp|P34248|YKK0_YEAST Probable intramembrane protease YKL100C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL100C PE=1 SV=1 225 556 8.0E-20
sp|Q6ZGL9|SIP1_ORYSJ Signal peptide peptidase 1 OS=Oryza sativa subsp. japonica GN=SPP1 PE=2 SV=1 226 357 1.0E-18
sp|O81062|SIP_ARATH Signal peptide peptidase OS=Arabidopsis thaliana GN=SPP PE=2 SV=1 260 357 2.0E-17
sp|B9FJ61|SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica GN=SPP2 PE=2 SV=1 267 357 5.0E-17
sp|Q9UTA3|YL8H_SCHPO Probable intramembrane protease C25B8.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.17 PE=3 SV=1 237 360 1.0E-16
sp|Q7G7C7|SIPL1_ORYSJ Signal peptide peptidase-like 1 OS=Oryza sativa subsp. japonica GN=SPPL1 PE=2 SV=1 236 492 6.0E-15
sp|Q8TCT6|SPPL3_HUMAN Signal peptide peptidase-like 3 OS=Homo sapiens GN=SPPL3 PE=1 SV=1 245 492 2.0E-13
sp|Q9CUS9|SPPL3_MOUSE Signal peptide peptidase-like 3 OS=Mus musculus GN=Sppl3 PE=1 SV=3 245 492 3.0E-13
sp|Q9D8V0|HM13_MOUSE Minor histocompatibility antigen H13 OS=Mus musculus GN=Hm13 PE=1 SV=1 252 359 1.0E-11
sp|Q8TCT9|HM13_HUMAN Minor histocompatibility antigen H13 OS=Homo sapiens GN=HM13 PE=1 SV=1 252 359 2.0E-11
sp|Q9D8V0|HM13_MOUSE Minor histocompatibility antigen H13 OS=Mus musculus GN=Hm13 PE=1 SV=1 435 500 2.0E-09
sp|Q8TCT9|HM13_HUMAN Minor histocompatibility antigen H13 OS=Homo sapiens GN=HM13 PE=1 SV=1 435 504 3.0E-09
sp|Q9JJF9|SPP2A_MOUSE Signal peptide peptidase-like 2A OS=Mus musculus GN=Sppl2a PE=1 SV=2 437 503 4.0E-09
sp|Q53P98|SIPL2_ORYSJ Signal peptide peptidase-like 2 OS=Oryza sativa subsp. japonica GN=SPPL2 PE=2 SV=1 335 503 1.0E-08
sp|B9FJ61|SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica GN=SPP2 PE=2 SV=1 434 511 4.0E-08
sp|Q8TCT8|SPP2A_HUMAN Signal peptide peptidase-like 2A OS=Homo sapiens GN=SPPL2A PE=1 SV=2 437 507 4.0E-08
sp|Q6ZGL9|SIP1_ORYSJ Signal peptide peptidase 1 OS=Oryza sativa subsp. japonica GN=SPP1 PE=2 SV=1 434 496 1.0E-07
sp|Q93Z32|SIPL1_ARATH Signal peptide peptidase-like 1 OS=Arabidopsis thaliana GN=SPPL1 PE=2 SV=1 240 356 2.0E-07
sp|Q9UTA3|YL8H_SCHPO Probable intramembrane protease C25B8.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.17 PE=3 SV=1 434 501 3.0E-06
sp|Q5N808|SIPL3_ORYSJ Signal peptide peptidase-like 3 OS=Oryza sativa subsp. japonica GN=SPPL3 PE=2 SV=1 437 492 3.0E-06
sp|Q0WMJ8|SIPL4_ARATH Signal peptide peptidase-like 4 OS=Arabidopsis thaliana GN=SPPL4 PE=2 SV=1 428 495 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0004190 aspartic-type endopeptidase activity Yes
GO:0016787 hydrolase activity No
GO:0110165 cellular anatomical entity No
GO:0140096 catalytic activity, acting on a protein No
GO:0004175 endopeptidase activity No
GO:0031224 intrinsic component of membrane No
GO:0070001 aspartic-type peptidase activity No
GO:0003824 catalytic activity No
GO:0005575 cellular_component No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22
2 82 100 18
3 121 143 22
4 240 262 22
5 267 284 17
6 294 316 22
7 336 355 19
8 437 459 22
9 466 483 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 37.04 20.00 54.07
CcL In ants, during behavior modification 76.34 41.25 111.43
CcD In ants, recently dead 54.85 29.67 80.03

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000770 yes
SC16a CcD 0.082616 no
CcL CcD 0.144424 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2443
MSAEPLAPMEAPASTSPLAFLQERHFLLLELKLLAGAVGIIYVGAHAALRRPPSASPVKRDSKKADEEDDGPVSQ
GLELSDAIAFPLMAAAMLIGLYYLIQWLQDPALLNKMLRSYMSAMSLASLTTLFAHGLDVLSSAIFPTWWRGGDG
LLRRADQRACAVVVCDDGGNAFVDGKLDDADKAIVAGKFDTLPRQGPLPGFLGLLTRSARARRLVWAVRGVLTRR
WVARFFVHGVVDDKTSIKFSHIMGLLLSAATAVVYFWTSSPLLSNLLGYSLCYGSFLILSPTDLLTGSLVLVGLF
VYDIVMVFYTPYMLTVATQLDVPIKLTFQSAARKSMLGLGDIVLPGMLMGWALRLDLYLHYLRKVKYESAELKVI
ERDASSGEIVSRTETKHKEVKARYANVKGRWGDALWTRGLLFLSSPRQLPVELAAASFRKTYFHATVAGYTLGLA
VTMAMLLVFEKGQPALLYLVPGVLGSLMVTAWARGEMGDVWKYSEDGSLDTVDVVVDLDAEGRVVKTVGKAEDGV
VDTTRDKDKDGSSKKDGDGKDGSRKKDDDGKDGSRKKDDNGKDGGGGRDKGRQIMLLSLEAASDCKEDD
Coding >Ophio5|2443
ATGTCGGCCGAACCTCTGGCGCCCATGGAAGCGCCGGCATCGACTTCACCCCTAGCCTTCCTCCAGGAGCGTCAT
TTTTTACTTCTGGAGCTGAAGCTTCTCGCCGGCGCCGTCGGCATCATCTACGTCGGAGCCCACGCCGCACTACGC
CGCCCGCCCTCGGCATCACCCGTCAAGCGCGACAGTAAGAAAGCCGACGAGGAAGACGATGGGCCTGTTTCGCAA
GGTCTGGAACTATCCGATGCCATCGCGTTTCCGCTCATGGCCGCGGCGATGCTCATCGGACTGTACTATCTGATC
CAGTGGCTTCAGGATCCGGCTTTACTGAATAAGATGCTGAGATCGTACATGTCAGCCATGTCTTTGGCGAGCTTG
ACGACCTTGTTTGCTCATGGTCTTGACGTGCTCTCGTCGGCCATTTTCCCGACGTGGTGGCGTGGGGGGGATGGG
CTGCTGAGGAGGGCTGACCAGAGGGCTTGCGCTGTGGTTGTTTGTGATGATGGGGGTAATGCCTTCGTTGACGGC
AAGCTCGACGACGCGGATAAGGCCATCGTCGCCGGCAAATTCGATACGCTGCCCAGACAGGGGCCGCTTCCGGGC
TTTCTGGGCCTGCTTACCCGCTCGGCGAGGGCGAGGCGCTTGGTCTGGGCTGTTCGCGGCGTCTTGACCAGGCGC
TGGGTCGCCCGGTTCTTCGTCCATGGCGTCGTCGATGACAAGACCAGCATCAAGTTCTCTCACATCATGGGCTTG
CTGCTCTCTGCCGCTACGGCGGTCGTCTACTTTTGGACCTCGTCGCCCTTGCTCTCCAACCTGTTGGGATATAGT
CTTTGCTATGGATCGTTTCTCATCCTGTCGCCTACGGACTTGCTCACGGGCTCTCTTGTTCTCGTTGGCCTCTTC
GTCTACGACATTGTCATGGTATTCTATACACCGTACATGTTGACCGTCGCCACCCAGCTGGATGTTCCCATCAAG
CTCACCTTTCAGTCTGCCGCTCGGAAAAGCATGTTGGGTCTGGGAGACATCGTCCTCCCGGGCATGCTCATGGGA
TGGGCGCTGCGCCTTGACCTCTACCTGCACTACCTGCGCAAGGTCAAGTACGAGTCCGCCGAGCTGAAAGTCATC
GAGCGGGACGCGTCGTCGGGCGAGATTGTGTCGCGGACCGAGACGAAGCACAAGGAGGTCAAGGCACGGTACGCC
AATGTCAAGGGCCGGTGGGGAGACGCCTTGTGGACGCGCGGCCTGCTTTTTCTCTCGAGCCCGCGACAGCTGCCG
GTCGAGCTGGCGGCGGCGAGCTTCCGCAAGACGTACTTTCACGCCACCGTTGCCGGCTACACGCTGGGGCTGGCC
GTCACCATGGCGATGCTGCTCGTCTTCGAGAAGGGCCAGCCGGCGCTGCTGTACCTCGTCCCCGGCGTGCTCGGC
TCCCTGATGGTGACGGCGTGGGCCCGAGGCGAGATGGGCGACGTTTGGAAGTACAGCGAGGACGGCAGCCTCGAC
ACCGTGGACGTGGTCGTCGACCTCGACGCCGAGGGGAGGGTGGTCAAGACGGTTGGTAAGGCCGAAGATGGGGTC
GTGGACACGACTCGAGACAAGGACAAGGATGGCAGCAGCAAGAAGGACGGCGATGGCAAGGACGGCAGCCGCAAA
AAGGACGACGACGGCAAGGACGGCAGCCGCAAAAAGGACGACAATGGTAAGGACGGCGGTGGCGGAAGGGACAAG
GGCCGTCAGATCATGTTGCTGTCGCTCGAGGCGGCGTCGGACTGCAAAGAGGATGAC
Transcript >Ophio5|2443
ATGTCGGCCGAACCTCTGGCGCCCATGGAAGCGCCGGCATCGACTTCACCCCTAGCCTTCCTCCAGGAGCGTCAT
TTTTTACTTCTGGAGCTGAAGCTTCTCGCCGGCGCCGTCGGCATCATCTACGTCGGAGCCCACGCCGCACTACGC
CGCCCGCCCTCGGCATCACCCGTCAAGCGCGACAGTAAGAAAGCCGACGAGGAAGACGATGGGCCTGTTTCGCAA
GGTCTGGAACTATCCGATGCCATCGCGTTTCCGCTCATGGCCGCGGCGATGCTCATCGGACTGTACTATCTGATC
CAGTGGCTTCAGGATCCGGCTTTACTGAATAAGATGCTGAGATCGTACATGTCAGCCATGTCTTTGGCGAGCTTG
ACGACCTTGTTTGCTCATGGTCTTGACGTGCTCTCGTCGGCCATTTTCCCGACGTGGTGGCGTGGGGGGGATGGG
CTGCTGAGGAGGGCTGACCAGAGGGCTTGCGCTGTGGTTGTTTGTGATGATGGGGGTAATGCCTTCGTTGACGGC
AAGCTCGACGACGCGGATAAGGCCATCGTCGCCGGCAAATTCGATACGCTGCCCAGACAGGGGCCGCTTCCGGGC
TTTCTGGGCCTGCTTACCCGCTCGGCGAGGGCGAGGCGCTTGGTCTGGGCTGTTCGCGGCGTCTTGACCAGGCGC
TGGGTCGCCCGGTTCTTCGTCCATGGCGTCGTCGATGACAAGACCAGCATCAAGTTCTCTCACATCATGGGCTTG
CTGCTCTCTGCCGCTACGGCGGTCGTCTACTTTTGGACCTCGTCGCCCTTGCTCTCCAACCTGTTGGGATATAGT
CTTTGCTATGGATCGTTTCTCATCCTGTCGCCTACGGACTTGCTCACGGGCTCTCTTGTTCTCGTTGGCCTCTTC
GTCTACGACATTGTCATGGTATTCTATACACCGTACATGTTGACCGTCGCCACCCAGCTGGATGTTCCCATCAAG
CTCACCTTTCAGTCTGCCGCTCGGAAAAGCATGTTGGGTCTGGGAGACATCGTCCTCCCGGGCATGCTCATGGGA
TGGGCGCTGCGCCTTGACCTCTACCTGCACTACCTGCGCAAGGTCAAGTACGAGTCCGCCGAGCTGAAAGTCATC
GAGCGGGACGCGTCGTCGGGCGAGATTGTGTCGCGGACCGAGACGAAGCACAAGGAGGTCAAGGCACGGTACGCC
AATGTCAAGGGCCGGTGGGGAGACGCCTTGTGGACGCGCGGCCTGCTTTTTCTCTCGAGCCCGCGACAGCTGCCG
GTCGAGCTGGCGGCGGCGAGCTTCCGCAAGACGTACTTTCACGCCACCGTTGCCGGCTACACGCTGGGGCTGGCC
GTCACCATGGCGATGCTGCTCGTCTTCGAGAAGGGCCAGCCGGCGCTGCTGTACCTCGTCCCCGGCGTGCTCGGC
TCCCTGATGGTGACGGCGTGGGCCCGAGGCGAGATGGGCGACGTTTGGAAGTACAGCGAGGACGGCAGCCTCGAC
ACCGTGGACGTGGTCGTCGACCTCGACGCCGAGGGGAGGGTGGTCAAGACGGTTGGTAAGGCCGAAGATGGGGTC
GTGGACACGACTCGAGACAAGGACAAGGATGGCAGCAGCAAGAAGGACGGCGATGGCAAGGACGGCAGCCGCAAA
AAGGACGACGACGGCAAGGACGGCAGCCGCAAAAAGGACGACAATGGTAAGGACGGCGGTGGCGGAAGGGACAAG
GGCCGTCAGATCATGTTGCTGTCGCTCGAGGCGGCGTCGGACTGCAAAGAGGATGACTAG
Gene >Ophio5|2443
ATGTCGGCCGAACCTCTGGCGCCCATGGAAGCGCCGGCATCGACTTCACCCCTAGCCTTCCTCCAGGAGCGTCAT
TTTTTACTTCTGGAGCTGAAGCTTCTCGCCGGCGCCGTCGGCATCATCTACGTCGGAGCCCACGCCGCACTACGC
CGCCCGCCCTCGGCATCACCCGTCAAGCGCGACAGTAAGAAAGCCGACGAGGAAGACGATGGGCCTGTTTCGCAA
GGTCTGGAACTATCCGATGCCATCGCGTTTCCGCTCATGGCCGCGGCGATGCTCATCGGACTGTACTATCTGATC
CAGTGGCTTCAGGATCCGGCTTTACTGAATAAGATGCTGAGATCGTACATGTCAGCCATGTCTTTGGCGAGCTTG
ACGACCTTGTTTGCTCATGGTCTTGACGTGCTCTCGTCGGCCATTTTCCCGACGTGGTGGCGTGGGGGGGATGGG
CTGCTGAGGAGGGCTGACCAGAGGGCTTGCGCTGTGGTTGTTTGTGATGATGGGGGTAATGCCTTCGTTGACGGC
AAGCTCGACGACGCGGATAAGGCCATCGTCGCCGGCAAATTCGATACGCTGCCCAGACAGGGGCCGCTTCCGGGC
TTTCTGGGCCTGCTTACCCGCTCGGCGAGGGCGAGGCGCTTGGTCTGGGCTGTTCGCGGCGTCTTGACCAGGCGC
TGGGTCGCCCGGTTCTTCGTCCATGGCGTCGTCGATGACAAGACCAGCATCAAGTTCTCTCACATCATGGGCTTG
CTGCTCTCTGCCGCTACGGCGGTCGTCTACTTTTGGACCTCGTCGCCCTTGCTCTCCAACCTGTTGGGATATAGT
CTTTGCTATGGATCGTTTCTCATCCTGTCGCCTACGGACTTGCTCACGGGCTCTCTTGTTCTCGTTGGCCTCTTC
GTCTACGACATTGTCATGGTATTCTATACGTGCGTCTCTCCTCTGCCCCCCCCCCCCTTTCTCCGTCTTCCCCCG
GCCATGAACTAACGACCGTCACCCAGACCGTACATGTTGACCGTCGCCACCCAGCTGGATGTTCCCATCAAGCTC
ACCTTTCAGTCTGCCGCTCGGAAAAGCATGTTGGGTCTGGGAGACATCGTCCTCCCGGGCATGCTCATGGGATGG
GCGCTGCGCCTTGACCTCTACCTGCACTACCTGCGCAAGGTCAAGTACGAGTCCGCCGAGCTGAAAGTCATCGAG
CGGGACGCGTCGTCGGGCGAGATTGTGTCGCGGACCGAGACGAAGCACAAGGAGGTCAAGGCACGGTACGCCAAT
GTCAAGGGCCGGTGGGGAGACGCCTTGTGGACGCGCGGCCTGCTTTTTCTCTCGAGCCCGCGACAGCTGCCGGTC
GAGCTGGCGGCGGCGAGCTTCCGCAAGACGTACTTTCACGCCACCGTTGCCGGCTACACGCTGGGGCTGGCCGTC
ACCATGGCGATGCTGCTCGTCTTCGAGAAGGGCCAGCCGGCGCTGCTGTACCTCGTCCCCGGCGTGCTCGGCTCC
CTGATGGTGACGGCGTGGGCCCGAGGCGAGATGGGCGACGTTTGGAAGTACAGCGAGGACGGCAGCCTCGACACC
GTGGACGTGGTCGTCGACCTCGACGCCGAGGGGAGGGTGGTCAAGACGGTTGGTAAGGCCGAAGATGGGGTCGTG
GACACGACTCGAGACAAGGACAAGGATGGCAGCAGCAAGAAGGACGGCGATGGCAAGGACGGCAGCCGCAAAAAG
GACGACGACGGCAAGGACGGCAGCCGCAAAAAGGACGACAATGGTAAGGACGGCGGTGGCGGAAGGGACAAGGGC
CGTCAGATCATGTTGCTGTCGCTCGAGGCGGCGTCGGACTGCAAAGAGGATGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail