Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2433
Gene name
Locationscaffold_201:24401..25734
Strand+
Gene length (bp)1333
Transcript length (bp)1239
Coding sequence length (bp)1236
Protein length (aa) 412

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 389 411 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 75.67 41.48 109.86
CcL In ants, during behavior modification 28.77 13.71 43.84
CcD In ants, recently dead 22.49 10.13 34.84

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.384318 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2433
MASLRLAPFDVPQPTALRKLPPDPGAKILPQHLAFASLEPIVILAAADRPPLGSGSDVLVLAAQQAACPAGMNSC
AAQKAPNKCCHEGTYCTDVPDASVGHVACCPNGARCGGQVGSCPSDATSCPSELGGGCCIAGYVCRGFGCVPRDS
PAGPSSSVPTPDAYRPVETSRTQGAEGGGGIAPMPFTSVVVTPTPTPTPTPTPTESSTTWEPWTTSSSSTESSDT
TTMASLATSESATSSSPSTSDTTTSAGPPWRPTGPSPTTTTTTTSPDESSTQTGCPTGFYGCLATHGGGCCRTDR
NCQTHSCPATTTTTVVASNGATIVVPGARGPQTRCADGWFACADDGCCPSGYQCGSASCVATETGSTSTVGKQPA
QTGGAAGMRGRRRLLLLLLIEGCYCYWFLLVMLGLAA
Coding >Ophio5|2433
ATGGCGTCGCTCCGCCTTGCGCCCTTTGACGTACCGCAGCCGACAGCTTTGAGGAAGCTGCCTCCCGACCCAGGC
GCCAAGATCCTTCCACAACATCTCGCCTTTGCATCTCTGGAGCCCATCGTCATCCTCGCCGCCGCTGACCGGCCG
CCTCTCGGCTCCGGCTCGGATGTTCTGGTGCTCGCGGCGCAGCAGGCGGCATGTCCTGCTGGGATGAACAGCTGT
GCTGCGCAGAAAGCGCCCAACAAATGCTGTCATGAGGGAACGTACTGCACCGACGTCCCGGACGCCAGCGTCGGT
CATGTCGCCTGCTGTCCCAACGGGGCGCGATGCGGCGGTCAGGTCGGTAGCTGTCCGTCTGACGCTACGAGCTGC
CCGTCCGAGCTGGGTGGCGGGTGCTGTATCGCCGGATATGTCTGCCGCGGCTTCGGATGTGTTCCTCGTGACTCT
CCTGCGGGTCCTTCGTCTTCGGTACCGACGCCTGATGCCTATCGCCCGGTCGAGACGAGCCGGACGCAGGGCGCT
GAAGGAGGCGGCGGCATCGCGCCCATGCCCTTTACCAGCGTGGTTGTTACGCCGACGCCGACACCGACACCGACA
CCGACTCCCACCGAGAGCTCCACAACCTGGGAACCTTGGACGACTTCCAGCAGCTCGACGGAATCATCAGATACC
ACTACCATGGCCAGCCTCGCAACATCCGAAAGTGCCACCAGCTCGAGTCCATCGACGTCTGACACGACCACGAGC
GCCGGCCCTCCCTGGCGTCCCACTGGTCCTTCACCGACGACGACGACGACGACGACGTCGCCCGACGAGTCCAGC
ACACAGACAGGGTGCCCCACCGGCTTCTACGGTTGCCTAGCCACGCACGGGGGCGGTTGCTGCCGAACAGACCGC
AACTGCCAAACACACTCATGCCCGGCGACAACGACGACAACCGTCGTGGCATCCAACGGCGCGACCATTGTGGTG
CCGGGCGCGCGGGGTCCCCAGACAAGGTGCGCCGACGGATGGTTCGCCTGTGCCGACGATGGCTGCTGCCCGAGT
GGATATCAATGCGGGTCTGCGAGCTGTGTGGCTACTGAGACTGGCAGCACCAGCACCGTGGGGAAGCAGCCGGCG
CAGACGGGCGGCGCGGCTGGCATGAGAGGGAGGAGAAGGCTGCTGTTGCTGCTGCTTATAGAGGGCTGCTATTGC
TACTGGTTCCTTTTGGTGATGCTGGGATTGGCGGCG
Transcript >Ophio5|2433
ATGGCGTCGCTCCGCCTTGCGCCCTTTGACGTACCGCAGCCGACAGCTTTGAGGAAGCTGCCTCCCGACCCAGGC
GCCAAGATCCTTCCACAACATCTCGCCTTTGCATCTCTGGAGCCCATCGTCATCCTCGCCGCCGCTGACCGGCCG
CCTCTCGGCTCCGGCTCGGATGTTCTGGTGCTCGCGGCGCAGCAGGCGGCATGTCCTGCTGGGATGAACAGCTGT
GCTGCGCAGAAAGCGCCCAACAAATGCTGTCATGAGGGAACGTACTGCACCGACGTCCCGGACGCCAGCGTCGGT
CATGTCGCCTGCTGTCCCAACGGGGCGCGATGCGGCGGTCAGGTCGGTAGCTGTCCGTCTGACGCTACGAGCTGC
CCGTCCGAGCTGGGTGGCGGGTGCTGTATCGCCGGATATGTCTGCCGCGGCTTCGGATGTGTTCCTCGTGACTCT
CCTGCGGGTCCTTCGTCTTCGGTACCGACGCCTGATGCCTATCGCCCGGTCGAGACGAGCCGGACGCAGGGCGCT
GAAGGAGGCGGCGGCATCGCGCCCATGCCCTTTACCAGCGTGGTTGTTACGCCGACGCCGACACCGACACCGACA
CCGACTCCCACCGAGAGCTCCACAACCTGGGAACCTTGGACGACTTCCAGCAGCTCGACGGAATCATCAGATACC
ACTACCATGGCCAGCCTCGCAACATCCGAAAGTGCCACCAGCTCGAGTCCATCGACGTCTGACACGACCACGAGC
GCCGGCCCTCCCTGGCGTCCCACTGGTCCTTCACCGACGACGACGACGACGACGACGTCGCCCGACGAGTCCAGC
ACACAGACAGGGTGCCCCACCGGCTTCTACGGTTGCCTAGCCACGCACGGGGGCGGTTGCTGCCGAACAGACCGC
AACTGCCAAACACACTCATGCCCGGCGACAACGACGACAACCGTCGTGGCATCCAACGGCGCGACCATTGTGGTG
CCGGGCGCGCGGGGTCCCCAGACAAGGTGCGCCGACGGATGGTTCGCCTGTGCCGACGATGGCTGCTGCCCGAGT
GGATATCAATGCGGGTCTGCGAGCTGTGTGGCTACTGAGACTGGCAGCACCAGCACCGTGGGGAAGCAGCCGGCG
CAGACGGGCGGCGCGGCTGGCATGAGAGGGAGGAGAAGGCTGCTGTTGCTGCTGCTTATAGAGGGCTGCTATTGC
TACTGGTTCCTTTTGGTGATGCTGGGATTGGCGGCGTGA
Gene >Ophio5|2433
ATGGCGTCGCTCCGCCTTGCGCCCTTTGACGTACCGCAGCCGACAGCTTTGAGGAAGCTGCCTCCCGACCCAGGC
GCCAAGATCCTTCCACAACATCTCGCCTTTGCATCTCTGGAGCCCATCGTCATCCTCGCCGCCGCTGACCGGCCG
CCTCTCGGCTCCGGCTCGGATGTTCTGGTGCTCGCGGCGCAGCAGGCGGCATGTCCTGCTGGGATGAACAGCTGT
GCTGCGCAGAAAGCGCCCAACAAATGCTGTCATGAGGGAACGTACTGCACCGACGTCCCGGACGCCAGCGTCGGT
CATGTCGCCTGCTGTCCCAACGGGGCGCGATGCGGCGGTCAGGTCGGTAGCTGTCCGTCTGACGCTACGAGCTGC
CCGTCCGAGCTGGGTGGCGGGTGCTGTATCGCCGGATATGTCTGCCGCGGCTTCGGATGTACGTTGTCGCGCCAG
TTATGGGGGGAAGGGAGTGGTGTGATGGATCGTCATGATGACCTCGCCGAGGGTGTGAGGACCGTTTGTTGCCAT
AGGTGTTCCTCGTGACTCTCCTGCGGGTCCTTCGTCTTCGGTACCGACGCCTGATGCCTATCGCCCGGTCGAGAC
GAGCCGGACGCAGGGCGCTGAAGGAGGCGGCGGCATCGCGCCCATGCCCTTTACCAGCGTGGTTGTTACGCCGAC
GCCGACACCGACACCGACACCGACTCCCACCGAGAGCTCCACAACCTGGGAACCTTGGACGACTTCCAGCAGCTC
GACGGAATCATCAGATACCACTACCATGGCCAGCCTCGCAACATCCGAAAGTGCCACCAGCTCGAGTCCATCGAC
GTCTGACACGACCACGAGCGCCGGCCCTCCCTGGCGTCCCACTGGTCCTTCACCGACGACGACGACGACGACGAC
GTCGCCCGACGAGTCCAGCACACAGACAGGGTGCCCCACCGGCTTCTACGGTTGCCTAGCCACGCACGGGGGCGG
TTGCTGCCGAACAGACCGCAACTGCCAAACACACTCATGCCCGGCGACAACGACGACAACCGTCGTGGCATCCAA
CGGCGCGACCATTGTGGTGCCGGGCGCGCGGGGTCCCCAGACAAGGTGCGCCGACGGATGGTTCGCCTGTGCCGA
CGATGGCTGCTGCCCGAGTGGATATCAATGCGGGTCTGCGAGCTGTGTGGCTACTGAGACTGGCAGCACCAGCAC
CGTGGGGAAGCAGCCGGCGCAGACGGGCGGCGCGGCTGGCATGAGAGGGAGGAGAAGGCTGCTGTTGCTGCTGCT
TATAGAGGGCTGCTATTGCTACTGGTTCCTTTTGGTGATGCTGGGATTGGCGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail