Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2428
Gene name
Locationscaffold_201:9798..10521
Strand+
Gene length (bp)723
Transcript length (bp)723
Coding sequence length (bp)720
Protein length (aa) 240

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18457 PUD1_2 Up-Regulated in long-lived daf-2 5.8E-56 34 218

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0617 0.0494 0.9448 0.0502 0.0477 0.0104 0.1186 0.1555 0.1001 0.004

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999754

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup341
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2680
Ophiocordyceps australis map64 (Brazil) OphauB2|4001
Ophiocordyceps camponoti-floridani Ophcf2|05468
Ophiocordyceps camponoti-floridani Ophcf2|05537
Ophiocordyceps camponoti-rufipedis Ophun1|3772
Ophiocordyceps camponoti-rufipedis Ophun1|5155
Ophiocordyceps kimflemingae Ophio5|1684
Ophiocordyceps kimflemingae Ophio5|2428 (this protein)
Ophiocordyceps kimflemingae Ophio5|7162
Ophiocordyceps subramaniannii Hirsu2|4506

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2428
MQITNILCVLLAAVEVSSAAPSPLQRRFDWGTVKRTAKVTIQNNSPDRIKSVSLVHKYSNVYKHRAEWPVIERFK
SPDEGNETTVEYNTGPFTTGRDWWLLSFYSDDMKTQFVTDPNNFRGFVDSLEGIGQLTTVSVAGATAGMVGALAG
PVTSVAASTAAVVVAKETTDALFNEETTVGFKQHILRADDEGKMTVIVINPDYTVTFYSTGSPSRTVTSRRPAAI
EVKNERGDVVDEIKQ
Coding >Ophio5|2428
ATGCAAATCACCAACATTCTTTGTGTGCTCCTCGCAGCCGTCGAGGTCAGCAGCGCGGCGCCGTCACCACTCCAA
CGTCGATTCGACTGGGGCACGGTCAAACGGACGGCAAAAGTCACGATCCAAAACAACTCGCCCGACCGCATCAAG
TCGGTGTCACTGGTGCACAAGTACAGCAACGTCTATAAGCATAGGGCGGAGTGGCCGGTGATTGAGAGATTCAAA
AGCCCCGACGAGGGCAATGAAACGACGGTCGAATATAACACCGGCCCATTCACCACCGGCAGAGACTGGTGGCTT
CTGAGCTTCTACAGCGACGACATGAAGACGCAGTTCGTGACGGACCCCAACAACTTTCGGGGCTTCGTCGATTCC
CTCGAAGGCATCGGCCAGCTCACGACTGTTAGTGTGGCCGGTGCTACGGCGGGAATGGTGGGCGCCTTGGCCGGA
CCCGTCACCAGCGTCGCCGCCTCCACCGCTGCCGTCGTCGTGGCGAAAGAGACAACGGACGCGCTGTTCAACGAG
GAGACGACAGTCGGATTCAAGCAACATATCCTCCGGGCAGATGACGAGGGTAAGATGACCGTCATCGTCATCAAC
CCGGACTATACCGTCACCTTTTACTCCACCGGATCACCCTCCCGTACCGTCACGTCCAGAAGGCCTGCCGCTATC
GAGGTCAAGAACGAAAGAGGAGATGTGGTGGATGAGATTAAGCAA
Transcript >Ophio5|2428
ATGCAAATCACCAACATTCTTTGTGTGCTCCTCGCAGCCGTCGAGGTCAGCAGCGCGGCGCCGTCACCACTCCAA
CGTCGATTCGACTGGGGCACGGTCAAACGGACGGCAAAAGTCACGATCCAAAACAACTCGCCCGACCGCATCAAG
TCGGTGTCACTGGTGCACAAGTACAGCAACGTCTATAAGCATAGGGCGGAGTGGCCGGTGATTGAGAGATTCAAA
AGCCCCGACGAGGGCAATGAAACGACGGTCGAATATAACACCGGCCCATTCACCACCGGCAGAGACTGGTGGCTT
CTGAGCTTCTACAGCGACGACATGAAGACGCAGTTCGTGACGGACCCCAACAACTTTCGGGGCTTCGTCGATTCC
CTCGAAGGCATCGGCCAGCTCACGACTGTTAGTGTGGCCGGTGCTACGGCGGGAATGGTGGGCGCCTTGGCCGGA
CCCGTCACCAGCGTCGCCGCCTCCACCGCTGCCGTCGTCGTGGCGAAAGAGACAACGGACGCGCTGTTCAACGAG
GAGACGACAGTCGGATTCAAGCAACATATCCTCCGGGCAGATGACGAGGGTAAGATGACCGTCATCGTCATCAAC
CCGGACTATACCGTCACCTTTTACTCCACCGGATCACCCTCCCGTACCGTCACGTCCAGAAGGCCTGCCGCTATC
GAGGTCAAGAACGAAAGAGGAGATGTGGTGGATGAGATTAAGCAATGA
Gene >Ophio5|2428
ATGCAAATCACCAACATTCTTTGTGTGCTCCTCGCAGCCGTCGAGGTCAGCAGCGCGGCGCCGTCACCACTCCAA
CGTCGATTCGACTGGGGCACGGTCAAACGGACGGCAAAAGTCACGATCCAAAACAACTCGCCCGACCGCATCAAG
TCGGTGTCACTGGTGCACAAGTACAGCAACGTCTATAAGCATAGGGCGGAGTGGCCGGTGATTGAGAGATTCAAA
AGCCCCGACGAGGGCAATGAAACGACGGTCGAATATAACACCGGCCCATTCACCACCGGCAGAGACTGGTGGCTT
CTGAGCTTCTACAGCGACGACATGAAGACGCAGTTCGTGACGGACCCCAACAACTTTCGGGGCTTCGTCGATTCC
CTCGAAGGCATCGGCCAGCTCACGACTGTTAGTGTGGCCGGTGCTACGGCGGGAATGGTGGGCGCCTTGGCCGGA
CCCGTCACCAGCGTCGCCGCCTCCACCGCTGCCGTCGTCGTGGCGAAAGAGACAACGGACGCGCTGTTCAACGAG
GAGACGACAGTCGGATTCAAGCAACATATCCTCCGGGCAGATGACGAGGGTAAGATGACCGTCATCGTCATCAAC
CCGGACTATACCGTCACCTTTTACTCCACCGGATCACCCTCCCGTACCGTCACGTCCAGAAGGCCTGCCGCTATC
GAGGTCAAGAACGAAAGAGGAGATGTGGTGGATGAGATTAAGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail