Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2422
Gene name
Locationscaffold_200:29653..31440
Strand+
Gene length (bp)1787
Transcript length (bp)1527
Coding sequence length (bp)1524
Protein length (aa) 508

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07958 DUF1688 Protein of unknown function (DUF1688) 2.1E-178 74 508

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A5H0J3|URC4_LACKL Uracil catabolism protein 4 OS=Lachancea kluyveri GN=URC4 PE=3 SV=1 70 508 8.0E-115
sp|Q9US42|URG3_SCHPO Protein urg3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=urg3 PE=2 SV=1 75 508 7.0E-105

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2422
MGFFSRKKAPKANSTITTVHSNTSFTSAKSPAVVHRASAGSITPVTPMSPMSPVKLPKVDLPRPPDPQLDPAGYL
RSLGAVRERSSLVMKRALRNDLDHFNVDLSKLPDVVAFVSRLIKRDYDAPFNTIPGHGRYQHFCVGDRDRVAQLL
ASWPDSIDNTEKCRRLIDLFLVSVLLDAGAGTQWSYQSPENGRTYRRSEGLAIASLDMFKAGLFSGNPANKAQVD
KVGLQSLTVEKLEAGLQSRTGNELAGLQGRTALLIRLADALDDKKDFFGVDGRPGNMIDHLLSHPSTLASSMLVV
PLPVLWNVLMSGLASIWPPSRTTLNGVSLGDAWPCSAMRRPDGAPWESILPFHKLTQWLTYSLMQPMQSLLNMHF
AGTELLTGLPEYRNGGLFVDIGVLTLKSDDQERGLQNYADYCRRTGTKGVEVAPMFEPGDDVVVEWRGVTVGLLD
TLCVEVNKALKVELAGNELTLPQLLEAGSWKGGREIAEINRPNTKEPPILIESDGTVF
Coding >Ophio5|2422
ATGGGCTTCTTCTCTCGCAAGAAGGCGCCCAAAGCCAATTCCACTATCACCACGGTTCACTCCAACACCAGCTTC
ACCTCGGCCAAGTCCCCCGCAGTCGTTCATCGCGCTTCGGCTGGTAGCATCACCCCTGTCACCCCCATGTCGCCC
ATGTCGCCTGTCAAGCTCCCCAAGGTCGACCTCCCTCGACCTCCGGACCCCCAGCTTGACCCGGCTGGCTATCTG
CGAAGCTTGGGCGCCGTCAGGGAAAGATCTAGCCTTGTCATGAAAAGAGCCCTTCGCAACGACCTGGATCATTTC
AACGTCGACCTTAGCAAGCTGCCTGATGTCGTCGCCTTTGTTTCGCGCTTGATCAAGCGCGATTACGATGCCCCG
TTCAACACAATCCCCGGCCACGGCCGCTACCAGCATTTCTGCGTTGGCGACCGCGACCGCGTTGCCCAGCTGTTG
GCCTCGTGGCCCGATAGCATCGACAACACCGAGAAGTGCCGTCGCCTCATCGATCTGTTCCTCGTGAGCGTCCTG
CTTGATGCCGGCGCCGGTACCCAATGGAGCTACCAGAGTCCCGAGAATGGACGCACCTACCGCCGCTCCGAGGGC
CTGGCAATTGCCAGCTTGGACATGTTCAAGGCGGGCCTCTTCTCGGGAAACCCTGCCAACAAGGCCCAAGTCGAC
AAGGTCGGCCTCCAGTCCCTCACCGTCGAGAAGCTCGAGGCCGGACTCCAGTCTCGTACTGGCAACGAGCTCGCC
GGCCTCCAGGGCCGCACAGCGCTTCTAATTCGACTGGCCGATGCTCTCGACGACAAGAAGGACTTTTTCGGTGTC
GATGGCCGCCCGGGTAACATGATAGATCATCTCTTGTCGCACCCGTCGACGCTGGCCTCGTCCATGCTAGTCGTT
CCGCTCCCCGTGCTGTGGAACGTCCTGATGAGCGGTCTGGCCAGCATCTGGCCGCCGTCACGGACCACGCTCAAC
GGGGTCTCCCTGGGCGATGCTTGGCCGTGCAGTGCCATGCGCAGACCCGATGGCGCGCCCTGGGAGTCGATACTG
CCCTTTCACAAGCTGACGCAGTGGCTCACGTACTCGCTCATGCAGCCCATGCAATCGCTGCTCAACATGCACTTT
GCCGGGACGGAGTTGCTCACGGGTCTTCCCGAATACCGCAACGGCGGCCTCTTCGTCGACATAGGTGTCCTGACG
CTCAAGTCGGACGACCAGGAGCGTGGATTACAGAACTACGCCGACTATTGCAGACGGACGGGCACCAAGGGGGTC
GAGGTAGCCCCCATGTTTGAGCCCGGAGACGACGTGGTAGTCGAGTGGAGAGGCGTCACCGTTGGGCTACTGGAC
ACGCTGTGTGTCGAGGTCAACAAGGCACTCAAGGTGGAGCTTGCCGGCAACGAGTTGACGCTGCCTCAGTTGCTA
GAGGCTGGCAGTTGGAAGGGCGGACGCGAGATTGCCGAGATTAATCGGCCGAACACCAAGGAACCGCCAATCCTG
ATTGAGAGCGACGGGACCGTCTTT
Transcript >Ophio5|2422
ATGGGCTTCTTCTCTCGCAAGAAGGCGCCCAAAGCCAATTCCACTATCACCACGGTTCACTCCAACACCAGCTTC
ACCTCGGCCAAGTCCCCCGCAGTCGTTCATCGCGCTTCGGCTGGTAGCATCACCCCTGTCACCCCCATGTCGCCC
ATGTCGCCTGTCAAGCTCCCCAAGGTCGACCTCCCTCGACCTCCGGACCCCCAGCTTGACCCGGCTGGCTATCTG
CGAAGCTTGGGCGCCGTCAGGGAAAGATCTAGCCTTGTCATGAAAAGAGCCCTTCGCAACGACCTGGATCATTTC
AACGTCGACCTTAGCAAGCTGCCTGATGTCGTCGCCTTTGTTTCGCGCTTGATCAAGCGCGATTACGATGCCCCG
TTCAACACAATCCCCGGCCACGGCCGCTACCAGCATTTCTGCGTTGGCGACCGCGACCGCGTTGCCCAGCTGTTG
GCCTCGTGGCCCGATAGCATCGACAACACCGAGAAGTGCCGTCGCCTCATCGATCTGTTCCTCGTGAGCGTCCTG
CTTGATGCCGGCGCCGGTACCCAATGGAGCTACCAGAGTCCCGAGAATGGACGCACCTACCGCCGCTCCGAGGGC
CTGGCAATTGCCAGCTTGGACATGTTCAAGGCGGGCCTCTTCTCGGGAAACCCTGCCAACAAGGCCCAAGTCGAC
AAGGTCGGCCTCCAGTCCCTCACCGTCGAGAAGCTCGAGGCCGGACTCCAGTCTCGTACTGGCAACGAGCTCGCC
GGCCTCCAGGGCCGCACAGCGCTTCTAATTCGACTGGCCGATGCTCTCGACGACAAGAAGGACTTTTTCGGTGTC
GATGGCCGCCCGGGTAACATGATAGATCATCTCTTGTCGCACCCGTCGACGCTGGCCTCGTCCATGCTAGTCGTT
CCGCTCCCCGTGCTGTGGAACGTCCTGATGAGCGGTCTGGCCAGCATCTGGCCGCCGTCACGGACCACGCTCAAC
GGGGTCTCCCTGGGCGATGCTTGGCCGTGCAGTGCCATGCGCAGACCCGATGGCGCGCCCTGGGAGTCGATACTG
CCCTTTCACAAGCTGACGCAGTGGCTCACGTACTCGCTCATGCAGCCCATGCAATCGCTGCTCAACATGCACTTT
GCCGGGACGGAGTTGCTCACGGGTCTTCCCGAATACCGCAACGGCGGCCTCTTCGTCGACATAGGTGTCCTGACG
CTCAAGTCGGACGACCAGGAGCGTGGATTACAGAACTACGCCGACTATTGCAGACGGACGGGCACCAAGGGGGTC
GAGGTAGCCCCCATGTTTGAGCCCGGAGACGACGTGGTAGTCGAGTGGAGAGGCGTCACCGTTGGGCTACTGGAC
ACGCTGTGTGTCGAGGTCAACAAGGCACTCAAGGTGGAGCTTGCCGGCAACGAGTTGACGCTGCCTCAGTTGCTA
GAGGCTGGCAGTTGGAAGGGCGGACGCGAGATTGCCGAGATTAATCGGCCGAACACCAAGGAACCGCCAATCCTG
ATTGAGAGCGACGGGACCGTCTTTTGA
Gene >Ophio5|2422
ATGGGCTTCTTCTCTCGCAAGAAGGCGCCCAAAGCCAATTCCACTATCACCACGGTTCACTCCAACACCAGCTTC
ACCTCGGCCAAGTCCCCCGCAGTCGTTCATCGCGCTTCGGCTGGTAGCATCACCCCTGTCACCCCCATGTCGCCC
ATGTCGCCTGTCAAGCTCCCCAAGGTCGACCTCCCTCGACCTCCGGACCCCCAGCTTGACCCGGCTGGCTATCTG
CGAAGCTTGGGCGCCGTCAGGGAAAGATCTAGCCTTGTCATGAAAAGAGCCCTTCGCAACGACCTGGATCATTTC
AACGTCGACCTTAGCAAGCTGCCTGATGTCGTCGCCTTTGTTTCGCGCTTGATCAAGGTGCGTTGACGCCACAGC
CGGCCTGCCTACCCATCTCCTGACGACTTTCCTTTTCCCGACGCAGCGCGATTACGATGCCCCGTTCAACACAAT
CCCCGGCCACGGCCGCTACCAGCATTTCTGCGTTGGCGACCGCGACCGCGTTGCCCAGCTGTTGGCCTCGTGGCC
CGATAGCATCGACAACACCGAGAAGTGCCGTCGCCTCATCGATCTGTTCCTCGTGAGCGTCCTGCTTGATGCCGG
CGCCGGTACCCAATGGAGCTACCAGAGTCCCGAGAATGGACGCACCTACCGCCGCTCCGAGGGCCTGGCAATTGC
CAGCTTGGACATGTTCAAGGCGGTATGCCTCTGCACTGCGAGACGCCATCGCTCTCGGCGCGGCTGACATTACGC
TCTCTAGGGCCTCTTCTCGGGAAACCCTGCCAACAAGGCCCAAGTCGACAAGGTCGGCCTCCAGTCCCTCACCGT
CGAGAAGCTCGAGGCCGGACTCCAGTCTCGTACTGGCAACGAGCTCGCCGGCCTCCAGGGCCGCACAGCGCTTCT
AATTCGACTGGCCGATGCTCTCGACGACAAGAAGGACTTTTTCGGTGTCGATGGCCGCCCGGGTAACATGATAGG
TTTGCCGTGTCCGCTCCTCGTCGCCGAAGGAGGAGAGGGGCCATAGATACTGACATGACTTGTCCATCCAGATCA
TCTCTTGTCGCACCCGTCGACGCTGGCCTCGTCCATGCTAGTCGTTCCGCTCCCCGTGCTGTGGAACGTCCTGAT
GAGCGGTCTGGCCAGCATCTGGCCGCCGTCACGGACCACGCTCAACGGGGTCTCCCTGGGCGATGCTTGGCCGTG
CAGTGCCATGCGCAGACCCGATGGCGCGCCCTGGGAGTCGATACTGCCCTTTCACAAGCTGACGCAGTGGCTCAC
GTACTCGCTCATGCAGCCCATGCAATCGCTGCTCAACATGCACTTTGCCGGGACGGAGTTGCTCACGGGTCTTCC
CGAATACCGCAACGGCGGCCTCTTCGTCGACATAGGTGTCCTGACGCTCAAGTCGGACGACCAGGAGCGTGGATT
ACAGAACTACGCCGACTATTGCAGACGGACGGGCACCAAGGGGGTCGAGGTAGCCCCCATGTTTGAGCCCGGAGA
CGACGTGGTAGTCGAGTGGAGAGGCGTCACCGTTGGGCTACTGGACACGCTGTGTGTCGAGGTCAACAAGGCACT
CAAGGTGGAGCTTGCCGGCAACGAGTTGACGCTGCCTCAGTTGCTAGAGGCTGGCAGTTGGAAGGTGAGCAGAGA
CAGACATGGGGTCCGGAACCGACGGCGCACACGGGAGGCTGACGTCAGGGCAGGGCGGACGCGAGATTGCCGAGA
TTAATCGGCCGAACACCAAGGAACCGCCAATCCTGATTGAGAGCGACGGGACCGTCTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail