Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2421
Gene name
Locationscaffold_200:27412..28255
Strand+
Gene length (bp)843
Transcript length (bp)843
Coding sequence length (bp)840
Protein length (aa) 280

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.26 0.00 0.81
CcL In ants, during behavior modification 12.43 3.14 21.71
CcD In ants, recently dead 7.15 1.56 12.74

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.082160 no
SC16a CcD 0.082160 no
CcL CcD 0.145081 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2421
MLPAAFLLAAIPAVMGTPPANASDASFPPANSERMRLTAMTKWFTLSAQPFIPGRPSKTVNNSIQVDFIRLVRGM
KVTPYWKESTPCHYPLVLEAINQTPLEKQRRPNATSSDAAGKGKKRNEDRPTNNTAVAQRNGSAIATPFYLHPIQ
KQIYADINSSSHVALVKTNPPPGVGPQVVELVCDPVYEGVAFKKIIFGAKGPELDNQPGVFFACPSPAPKSLSSE
APPIYLQWSTTGPPLGRSCVPLRMIAEKAPNPQDRSKDWSMACDYITVDGECKIH
Coding >Ophio5|2421
ATGTTGCCAGCAGCTTTTCTCCTGGCCGCCATTCCGGCGGTCATGGGCACTCCGCCGGCTAATGCTTCGGATGCG
AGCTTTCCGCCGGCTAATTCTGAGCGCATGCGCCTCACTGCCATGACTAAATGGTTCACTCTGTCCGCCCAACCG
TTTATTCCGGGACGTCCTTCAAAGACCGTCAACAACTCGATTCAAGTCGACTTCATTCGTCTCGTCCGGGGCATG
AAAGTCACTCCCTATTGGAAAGAAAGCACCCCGTGCCATTATCCCCTCGTCCTAGAGGCCATCAACCAGACGCCA
CTTGAAAAACAACGTCGCCCAAACGCGACCTCCTCAGACGCGGCGGGCAAGGGGAAAAAACGCAACGAAGACCGC
CCGACCAATAACACGGCAGTAGCCCAGAGGAATGGGTCGGCCATTGCAACCCCCTTTTACCTCCATCCGATCCAG
AAACAAATCTACGCCGATATAAACTCGTCATCGCACGTTGCTCTGGTGAAGACGAATCCGCCGCCTGGGGTAGGC
CCACAAGTCGTGGAGCTCGTATGCGATCCTGTATATGAGGGAGTCGCGTTCAAGAAAATCATCTTTGGAGCCAAG
GGTCCGGAATTAGATAACCAGCCTGGGGTCTTCTTCGCCTGTCCGTCGCCTGCGCCGAAGTCTCTGTCGTCTGAG
GCTCCCCCGATTTATCTTCAGTGGTCCACTACAGGGCCTCCTCTGGGACGGAGTTGTGTCCCGCTGAGGATGATT
GCTGAGAAGGCACCAAATCCCCAGGACCGGTCCAAGGACTGGTCGATGGCATGCGACTACATCACAGTTGATGGA
GAGTGTAAGATTCAT
Transcript >Ophio5|2421
ATGTTGCCAGCAGCTTTTCTCCTGGCCGCCATTCCGGCGGTCATGGGCACTCCGCCGGCTAATGCTTCGGATGCG
AGCTTTCCGCCGGCTAATTCTGAGCGCATGCGCCTCACTGCCATGACTAAATGGTTCACTCTGTCCGCCCAACCG
TTTATTCCGGGACGTCCTTCAAAGACCGTCAACAACTCGATTCAAGTCGACTTCATTCGTCTCGTCCGGGGCATG
AAAGTCACTCCCTATTGGAAAGAAAGCACCCCGTGCCATTATCCCCTCGTCCTAGAGGCCATCAACCAGACGCCA
CTTGAAAAACAACGTCGCCCAAACGCGACCTCCTCAGACGCGGCGGGCAAGGGGAAAAAACGCAACGAAGACCGC
CCGACCAATAACACGGCAGTAGCCCAGAGGAATGGGTCGGCCATTGCAACCCCCTTTTACCTCCATCCGATCCAG
AAACAAATCTACGCCGATATAAACTCGTCATCGCACGTTGCTCTGGTGAAGACGAATCCGCCGCCTGGGGTAGGC
CCACAAGTCGTGGAGCTCGTATGCGATCCTGTATATGAGGGAGTCGCGTTCAAGAAAATCATCTTTGGAGCCAAG
GGTCCGGAATTAGATAACCAGCCTGGGGTCTTCTTCGCCTGTCCGTCGCCTGCGCCGAAGTCTCTGTCGTCTGAG
GCTCCCCCGATTTATCTTCAGTGGTCCACTACAGGGCCTCCTCTGGGACGGAGTTGTGTCCCGCTGAGGATGATT
GCTGAGAAGGCACCAAATCCCCAGGACCGGTCCAAGGACTGGTCGATGGCATGCGACTACATCACAGTTGATGGA
GAGTGTAAGATTCATTAG
Gene >Ophio5|2421
ATGTTGCCAGCAGCTTTTCTCCTGGCCGCCATTCCGGCGGTCATGGGCACTCCGCCGGCTAATGCTTCGGATGCG
AGCTTTCCGCCGGCTAATTCTGAGCGCATGCGCCTCACTGCCATGACTAAATGGTTCACTCTGTCCGCCCAACCG
TTTATTCCGGGACGTCCTTCAAAGACCGTCAACAACTCGATTCAAGTCGACTTCATTCGTCTCGTCCGGGGCATG
AAAGTCACTCCCTATTGGAAAGAAAGCACCCCGTGCCATTATCCCCTCGTCCTAGAGGCCATCAACCAGACGCCA
CTTGAAAAACAACGTCGCCCAAACGCGACCTCCTCAGACGCGGCGGGCAAGGGGAAAAAACGCAACGAAGACCGC
CCGACCAATAACACGGCAGTAGCCCAGAGGAATGGGTCGGCCATTGCAACCCCCTTTTACCTCCATCCGATCCAG
AAACAAATCTACGCCGATATAAACTCGTCATCGCACGTTGCTCTGGTGAAGACGAATCCGCCGCCTGGGGTAGGC
CCACAAGTCGTGGAGCTCGTATGCGATCCTGTATATGAGGGAGTCGCGTTCAAGAAAATCATCTTTGGAGCCAAG
GGTCCGGAATTAGATAACCAGCCTGGGGTCTTCTTCGCCTGTCCGTCGCCTGCGCCGAAGTCTCTGTCGTCTGAG
GCTCCCCCGATTTATCTTCAGTGGTCCACTACAGGGCCTCCTCTGGGACGGAGTTGTGTCCCGCTGAGGATGATT
GCTGAGAAGGCACCAAATCCCCAGGACCGGTCCAAGGACTGGTCGATGGCATGCGACTACATCACAGTTGATGGA
GAGTGTAAGATTCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail