Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2417
Gene name
Locationscaffold_200:13239..14004
Strand+
Gene length (bp)765
Transcript length (bp)765
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14040 DNase_NucA_NucB Deoxyribonuclease NucA/NucB 1.5E-07 30 123

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 54.01 25.68 82.34
CcL In ants, during behavior modification 31.72 13.02 50.42
CcD In ants, recently dead 21.59 8.08 35.09

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.054615 no
SC16a CcD 0.001851 yes
CcL CcD 0.218450 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2417
MMLRKALPLALALPITASIAAEAAPPDITFLCQEMPDICTNMCWAVRCAKPTFSQQLTLDYPSDDLRRQRLESSG
CARCASNATVSARNDACNAYPFPDTSESVSSNASAVSRCVPREQQTKQDADVAILAKKFRQTGQRSFRINFGNPG
AAGVKYCLSEPCENDDREEQEEALQKRALAAPFRVFMTNSGMTVASMDDLGADYSFTRRVGAEEKLSPQAQMWQE
DFKGERYAFVTDSVVREMNAAEIRGKTGR
Coding >Ophio5|2417
ATGATGCTTCGAAAGGCTTTGCCCTTGGCCCTCGCCCTGCCCATCACGGCCTCGATAGCAGCCGAGGCGGCCCCT
CCGGACATCACCTTTCTCTGCCAAGAAATGCCCGACATCTGCACCAACATGTGTTGGGCCGTCCGCTGCGCGAAA
CCGACCTTCTCACAACAGTTAACGCTCGACTATCCATCCGACGACCTTCGTCGCCAACGTCTCGAATCGTCCGGC
TGCGCTCGTTGCGCCAGCAATGCTACCGTTTCCGCCCGGAATGACGCCTGCAACGCGTATCCGTTTCCCGACACG
AGCGAGAGCGTATCTTCCAACGCATCGGCCGTGTCCCGGTGCGTCCCTCGGGAACAGCAGACGAAGCAAGACGCC
GACGTTGCCATACTCGCCAAAAAGTTTCGCCAGACCGGCCAGCGAAGCTTCAGGATCAACTTTGGCAACCCCGGA
GCGGCGGGCGTTAAATACTGCCTCTCGGAGCCGTGTGAAAACGACGACCGGGAGGAGCAGGAGGAGGCTTTGCAG
AAGCGCGCTCTGGCGGCGCCCTTTAGAGTCTTTATGACTAATTCGGGCATGACTGTCGCTTCCATGGATGACCTG
GGTGCTGATTACAGCTTCACTCGCCGGGTTGGCGCTGAGGAAAAGCTCTCACCGCAGGCTCAGATGTGGCAGGAG
GATTTCAAGGGCGAGCGCTATGCCTTTGTAACGGACTCTGTTGTGAGGGAGATGAATGCAGCCGAAATTCGCGGC
AAGACTGGCAGA
Transcript >Ophio5|2417
ATGATGCTTCGAAAGGCTTTGCCCTTGGCCCTCGCCCTGCCCATCACGGCCTCGATAGCAGCCGAGGCGGCCCCT
CCGGACATCACCTTTCTCTGCCAAGAAATGCCCGACATCTGCACCAACATGTGTTGGGCCGTCCGCTGCGCGAAA
CCGACCTTCTCACAACAGTTAACGCTCGACTATCCATCCGACGACCTTCGTCGCCAACGTCTCGAATCGTCCGGC
TGCGCTCGTTGCGCCAGCAATGCTACCGTTTCCGCCCGGAATGACGCCTGCAACGCGTATCCGTTTCCCGACACG
AGCGAGAGCGTATCTTCCAACGCATCGGCCGTGTCCCGGTGCGTCCCTCGGGAACAGCAGACGAAGCAAGACGCC
GACGTTGCCATACTCGCCAAAAAGTTTCGCCAGACCGGCCAGCGAAGCTTCAGGATCAACTTTGGCAACCCCGGA
GCGGCGGGCGTTAAATACTGCCTCTCGGAGCCGTGTGAAAACGACGACCGGGAGGAGCAGGAGGAGGCTTTGCAG
AAGCGCGCTCTGGCGGCGCCCTTTAGAGTCTTTATGACTAATTCGGGCATGACTGTCGCTTCCATGGATGACCTG
GGTGCTGATTACAGCTTCACTCGCCGGGTTGGCGCTGAGGAAAAGCTCTCACCGCAGGCTCAGATGTGGCAGGAG
GATTTCAAGGGCGAGCGCTATGCCTTTGTAACGGACTCTGTTGTGAGGGAGATGAATGCAGCCGAAATTCGCGGC
AAGACTGGCAGATAG
Gene >Ophio5|2417
ATGATGCTTCGAAAGGCTTTGCCCTTGGCCCTCGCCCTGCCCATCACGGCCTCGATAGCAGCCGAGGCGGCCCCT
CCGGACATCACCTTTCTCTGCCAAGAAATGCCCGACATCTGCACCAACATGTGTTGGGCCGTCCGCTGCGCGAAA
CCGACCTTCTCACAACAGTTAACGCTCGACTATCCATCCGACGACCTTCGTCGCCAACGTCTCGAATCGTCCGGC
TGCGCTCGTTGCGCCAGCAATGCTACCGTTTCCGCCCGGAATGACGCCTGCAACGCGTATCCGTTTCCCGACACG
AGCGAGAGCGTATCTTCCAACGCATCGGCCGTGTCCCGGTGCGTCCCTCGGGAACAGCAGACGAAGCAAGACGCC
GACGTTGCCATACTCGCCAAAAAGTTTCGCCAGACCGGCCAGCGAAGCTTCAGGATCAACTTTGGCAACCCCGGA
GCGGCGGGCGTTAAATACTGCCTCTCGGAGCCGTGTGAAAACGACGACCGGGAGGAGCAGGAGGAGGCTTTGCAG
AAGCGCGCTCTGGCGGCGCCCTTTAGAGTCTTTATGACTAATTCGGGCATGACTGTCGCTTCCATGGATGACCTG
GGTGCTGATTACAGCTTCACTCGCCGGGTTGGCGCTGAGGAAAAGCTCTCACCGCAGGCTCAGATGTGGCAGGAG
GATTTCAAGGGCGAGCGCTATGCCTTTGTAACGGACTCTGTTGTGAGGGAGATGAATGCAGCCGAAATTCGCGGC
AAGACTGGCAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail