Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2405
Gene name
Locationscaffold_20:71115..72127
Strand-
Gene length (bp)1012
Transcript length (bp)876
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04893 Yip1 Yip1 domain 7.4E-12 94 252

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTD3|YIP5_SCHPO Protein YIP5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip5 PE=3 SV=1 10 264 2.0E-40
sp|Q9Y548|YIPF1_HUMAN Protein YIPF1 OS=Homo sapiens GN=YIPF1 PE=1 SV=1 69 263 9.0E-28
sp|Q6P6G5|YIPF1_RAT Protein YIPF1 OS=Rattus norvegicus GN=Yipf1 PE=2 SV=1 16 263 1.0E-27
sp|Q91VU1|YIPF1_MOUSE Protein YIPF1 OS=Mus musculus GN=Yipf1 PE=2 SV=1 16 263 2.0E-27
sp|Q5RBL0|YIPF1_PONAB Protein YIPF1 OS=Pongo abelii GN=YIPF1 PE=2 SV=1 68 263 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTD3|YIP5_SCHPO Protein YIP5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip5 PE=3 SV=1 10 264 2.0E-40
sp|Q9Y548|YIPF1_HUMAN Protein YIPF1 OS=Homo sapiens GN=YIPF1 PE=1 SV=1 69 263 9.0E-28
sp|Q6P6G5|YIPF1_RAT Protein YIPF1 OS=Rattus norvegicus GN=Yipf1 PE=2 SV=1 16 263 1.0E-27
sp|Q91VU1|YIPF1_MOUSE Protein YIPF1 OS=Mus musculus GN=Yipf1 PE=2 SV=1 16 263 2.0E-27
sp|Q5RBL0|YIPF1_PONAB Protein YIPF1 OS=Pongo abelii GN=YIPF1 PE=2 SV=1 68 263 3.0E-27
sp|Q54TS4|YIPF1_DICDI Protein YIPF1 homolog OS=Dictyostelium discoideum GN=yipf1 PE=3 SV=1 54 267 3.0E-26
sp|Q99LP8|YIPF2_MOUSE Protein YIPF2 OS=Mus musculus GN=Yipf2 PE=2 SV=1 66 263 2.0E-23
sp|Q9BWQ6|YIPF2_HUMAN Protein YIPF2 OS=Homo sapiens GN=YIPF2 PE=1 SV=1 69 273 9.0E-23
sp|Q5XIT3|YIPF2_RAT Protein YIPF2 OS=Rattus norvegicus GN=Yipf2 PE=2 SV=1 66 263 2.0E-19
sp|P53108|YIP5_YEAST Protein YIP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP5 PE=1 SV=1 71 263 4.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 111 133 22
2 148 170 22
3 183 202 19
4 207 229 22
5 242 264 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2405
MSGSGYDAVVDVDDEGDLGHTDLQEDLEFHNSNFQESTSGGSRKGRPAASLPPPVTAPTSSPSSKRFLWTMSFYA
QFFDVDTSAVLSRCWAALFPRANFLDVLEGNADLYGPFWIATTVVLILFLGGTISQYLSTTRSTPFAYDFRLLSG
AAGLVYGYTLFLPVLLFLALRYFGSELANLLECWALYGYSNLIWIPVAIISWSPLEVLNWVFVAVGFSMSVAFLV
RNLYPVLSATDKQISKVLLILVVMLHAGLSLTIKILFFAHGSPVARAPGQGGPGKPTGDDKTAGRF
Coding >Ophio5|2405
ATGTCCGGGTCCGGGTACGACGCAGTGGTGGACGTGGATGACGAGGGTGACCTTGGACACACGGATCTTCAGGAG
GATCTCGAATTCCACAACTCCAACTTCCAAGAGTCGACGTCTGGCGGCAGTCGCAAGGGTCGACCCGCGGCCAGC
CTCCCTCCTCCGGTTACGGCGCCAACATCGTCTCCGTCGTCGAAGCGCTTCCTCTGGACCATGTCCTTCTACGCG
CAGTTCTTCGATGTCGACACGTCAGCGGTGCTGTCGCGGTGCTGGGCTGCGCTCTTCCCGCGGGCTAACTTTCTC
GACGTGCTCGAGGGCAATGCCGACCTCTACGGGCCATTTTGGATCGCTACGACAGTCGTCCTCATCTTGTTCTTG
GGCGGCACTATAAGTCAGTACCTCTCGACGACGAGGTCTACGCCGTTTGCGTACGATTTTAGGCTTCTAAGCGGA
GCTGCTGGACTCGTGTACGGATATACACTCTTCCTCCCTGTACTCCTGTTCCTCGCCCTCCGATACTTTGGCAGC
GAGTTGGCCAACCTCCTGGAATGCTGGGCGCTGTACGGCTACTCCAATCTCATCTGGATCCCGGTGGCCATCATC
AGCTGGTCGCCGTTGGAGGTGCTCAACTGGGTTTTTGTCGCCGTCGGCTTCAGCATGTCCGTCGCCTTCCTCGTC
CGCAACCTGTACCCCGTGTTGAGCGCGACGGACAAGCAGATCAGCAAGGTGCTGCTGATTCTCGTCGTCATGCTC
CACGCCGGCCTGTCGCTCACCATCAAGATCCTGTTCTTCGCTCACGGCAGCCCGGTCGCGAGGGCTCCTGGGCAG
GGCGGCCCGGGAAAACCGACGGGCGACGACAAGACGGCAGGAAGGTTT
Transcript >Ophio5|2405
ATGTCCGGGTCCGGGTACGACGCAGTGGTGGACGTGGATGACGAGGGTGACCTTGGACACACGGATCTTCAGGAG
GATCTCGAATTCCACAACTCCAACTTCCAAGAGTCGACGTCTGGCGGCAGTCGCAAGGGTCGACCCGCGGCCAGC
CTCCCTCCTCCGGTTACGGCGCCAACATCGTCTCCGTCGTCGAAGCGCTTCCTCTGGACCATGTCCTTCTACGCG
CAGTTCTTCGATGTCGACACGTCAGCGGTGCTGTCGCGGTGCTGGGCTGCGCTCTTCCCGCGGGCTAACTTTCTC
GACGTGCTCGAGGGCAATGCCGACCTCTACGGGCCATTTTGGATCGCTACGACAGTCGTCCTCATCTTGTTCTTG
GGCGGCACTATAAGTCAGTACCTCTCGACGACGAGGTCTACGCCGTTTGCGTACGATTTTAGGCTTCTAAGCGGA
GCTGCTGGACTCGTGTACGGATATACACTCTTCCTCCCTGTACTCCTGTTCCTCGCCCTCCGATACTTTGGCAGC
GAGTTGGCCAACCTCCTGGAATGCTGGGCGCTGTACGGCTACTCCAATCTCATCTGGATCCCGGTGGCCATCATC
AGCTGGTCGCCGTTGGAGGTGCTCAACTGGGTTTTTGTCGCCGTCGGCTTCAGCATGTCCGTCGCCTTCCTCGTC
CGCAACCTGTACCCCGTGTTGAGCGCGACGGACAAGCAGATCAGCAAGGTGCTGCTGATTCTCGTCGTCATGCTC
CACGCCGGCCTGTCGCTCACCATCAAGATCCTGTTCTTCGCTCACGGCAGCCCGGTCGCGAGGGCTCCTGGGCAG
GGCGGCCCGGGAAAACCGACGGGCGACGACAAGACGGCAGGAAGGTTTTAG
Gene >Ophio5|2405
ATGTCCGGGTCCGGGTACGACGCAGTGGTGGACGTGGATGACGAGGTAGATGCTGCCTTTCCCTTACTTTCCCGC
CAGGGCAACGAAGCTGATGACCCATCTTTCCCCGTCTACGTATGCAGGGTGACCTTGGACACACGGATCTTCAGG
AGGATCTCGAATTCCACAACTCCAACTTCCAAGAGTCGACGTCTGGCGGCAGTCGCAAGGGTCGACCCGCGGCCA
GCCTCCCTCCTCCGGTTACGGCGCCAACATCGTCTCCGTCGTCGAAGCGCTTCCTCTGGACCATGTCCTTCTACG
CGCAGTTCTTCGATGTCGACACGTCAGCGGTGCTGTCGCGGTGCTGGGCTGCGCTCTTCCCGCGGGCTAACTTTC
TCGACGTGCTCGAGGGCAATGCCGACCTCTACGGGCCATTTTGGATCGCTACGACAGTCGTCCTCATCTTGTTCT
TGGGCGGCACTATAAGTCAGTACCTCTCGACGACGAGGTCTACGCCGTTTGCGTACGATTTTAGGCTTCTAAGCG
GTAAGGGCCCTACCAACGTTTGCCGCAAGCCAAAAGGCTGACGCGCATCTATCTACCAGGAGCTGCTGGACTCGT
GTACGGATATACACTCTTCCTCCCTGTACTCCTGTTCCTCGCCCTCCGATACTTTGGCAGCGAGTTGGCCAACCT
CCTGGAATGCTGGGCGCTGTACGGCTACTCCAATCTCATCTGGATCCCGGTGGCCATCATCAGCTGGTCGCCGTT
GGAGGTGCTCAACTGGGTTTTTGTCGCCGTCGGCTTCAGCATGTCCGTCGCCTTCCTCGTCCGCAACCTGTACCC
CGTGTTGAGCGCGACGGACAAGCAGATCAGCAAGGTGCTGCTGATTCTCGTCGTCATGCTCCACGCCGGCCTGTC
GCTCACCATCAAGATCCTGTTCTTCGCTCACGGCAGCCCGGTCGCGAGGGCTCCTGGGCAGGGCGGCCCGGGAAA
ACCGACGGGCGACGACAAGACGGCAGGAAGGTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail