Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2405
Gene name
Locationscaffold_20:71115..72127
Strand-
Gene length (bp)1012
Transcript length (bp)876
Coding sequence length (bp)873
Protein length (aa) 291

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04893 Yip1 Yip1 domain 7.4E-12 94 252

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTD3|YIP5_SCHPO Protein YIP5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip5 PE=3 SV=1 10 264 2.0E-40
sp|Q9Y548|YIPF1_HUMAN Protein YIPF1 OS=Homo sapiens GN=YIPF1 PE=1 SV=1 69 263 9.0E-28
sp|Q6P6G5|YIPF1_RAT Protein YIPF1 OS=Rattus norvegicus GN=Yipf1 PE=2 SV=1 16 263 1.0E-27
sp|Q91VU1|YIPF1_MOUSE Protein YIPF1 OS=Mus musculus GN=Yipf1 PE=2 SV=1 16 263 2.0E-27
sp|Q5RBL0|YIPF1_PONAB Protein YIPF1 OS=Pongo abelii GN=YIPF1 PE=2 SV=1 68 263 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTD3|YIP5_SCHPO Protein YIP5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip5 PE=3 SV=1 10 264 2.0E-40
sp|Q9Y548|YIPF1_HUMAN Protein YIPF1 OS=Homo sapiens GN=YIPF1 PE=1 SV=1 69 263 9.0E-28
sp|Q6P6G5|YIPF1_RAT Protein YIPF1 OS=Rattus norvegicus GN=Yipf1 PE=2 SV=1 16 263 1.0E-27
sp|Q91VU1|YIPF1_MOUSE Protein YIPF1 OS=Mus musculus GN=Yipf1 PE=2 SV=1 16 263 2.0E-27
sp|Q5RBL0|YIPF1_PONAB Protein YIPF1 OS=Pongo abelii GN=YIPF1 PE=2 SV=1 68 263 3.0E-27
sp|Q54TS4|YIPF1_DICDI Protein YIPF1 homolog OS=Dictyostelium discoideum GN=yipf1 PE=3 SV=1 54 267 3.0E-26
sp|Q99LP8|YIPF2_MOUSE Protein YIPF2 OS=Mus musculus GN=Yipf2 PE=2 SV=1 66 263 2.0E-23
sp|Q9BWQ6|YIPF2_HUMAN Protein YIPF2 OS=Homo sapiens GN=YIPF2 PE=1 SV=1 69 273 9.0E-23
sp|Q5XIT3|YIPF2_RAT Protein YIPF2 OS=Rattus norvegicus GN=Yipf2 PE=2 SV=1 66 263 2.0E-19
sp|P53108|YIP5_YEAST Protein YIP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP5 PE=1 SV=1 71 263 4.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Lysosome/Vacuole|Golgi apparatus Signal peptide|Transmembrane domain 0.0816 0.108 0.0343 0.1243 0.0801 0.0343 0.6287 0.7204 0.9109 0.0122

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 111 133 22
2 148 170 22
3 183 202 19
4 207 229 22
5 242 264 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5022
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5240
Ophiocordyceps australis map64 (Brazil) OphauB2|7322
Ophiocordyceps camponoti-floridani Ophcf2|04245
Ophiocordyceps camponoti-rufipedis Ophun1|4995
Ophiocordyceps kimflemingae Ophio5|2405 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2565

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2405
MSGSGYDAVVDVDDEGDLGHTDLQEDLEFHNSNFQESTSGGSRKGRPAASLPPPVTAPTSSPSSKRFLWTMSFYA
QFFDVDTSAVLSRCWAALFPRANFLDVLEGNADLYGPFWIATTVVLILFLGGTISQYLSTTRSTPFAYDFRLLSG
AAGLVYGYTLFLPVLLFLALRYFGSELANLLECWALYGYSNLIWIPVAIISWSPLEVLNWVFVAVGFSMSVAFLV
RNLYPVLSATDKQISKVLLILVVMLHAGLSLTIKILFFAHGSPVARAPGQGGPGKPTGDDKTAGRF
Coding >Ophio5|2405
ATGTCCGGGTCCGGGTACGACGCAGTGGTGGACGTGGATGACGAGGGTGACCTTGGACACACGGATCTTCAGGAG
GATCTCGAATTCCACAACTCCAACTTCCAAGAGTCGACGTCTGGCGGCAGTCGCAAGGGTCGACCCGCGGCCAGC
CTCCCTCCTCCGGTTACGGCGCCAACATCGTCTCCGTCGTCGAAGCGCTTCCTCTGGACCATGTCCTTCTACGCG
CAGTTCTTCGATGTCGACACGTCAGCGGTGCTGTCGCGGTGCTGGGCTGCGCTCTTCCCGCGGGCTAACTTTCTC
GACGTGCTCGAGGGCAATGCCGACCTCTACGGGCCATTTTGGATCGCTACGACAGTCGTCCTCATCTTGTTCTTG
GGCGGCACTATAAGTCAGTACCTCTCGACGACGAGGTCTACGCCGTTTGCGTACGATTTTAGGCTTCTAAGCGGA
GCTGCTGGACTCGTGTACGGATATACACTCTTCCTCCCTGTACTCCTGTTCCTCGCCCTCCGATACTTTGGCAGC
GAGTTGGCCAACCTCCTGGAATGCTGGGCGCTGTACGGCTACTCCAATCTCATCTGGATCCCGGTGGCCATCATC
AGCTGGTCGCCGTTGGAGGTGCTCAACTGGGTTTTTGTCGCCGTCGGCTTCAGCATGTCCGTCGCCTTCCTCGTC
CGCAACCTGTACCCCGTGTTGAGCGCGACGGACAAGCAGATCAGCAAGGTGCTGCTGATTCTCGTCGTCATGCTC
CACGCCGGCCTGTCGCTCACCATCAAGATCCTGTTCTTCGCTCACGGCAGCCCGGTCGCGAGGGCTCCTGGGCAG
GGCGGCCCGGGAAAACCGACGGGCGACGACAAGACGGCAGGAAGGTTT
Transcript >Ophio5|2405
ATGTCCGGGTCCGGGTACGACGCAGTGGTGGACGTGGATGACGAGGGTGACCTTGGACACACGGATCTTCAGGAG
GATCTCGAATTCCACAACTCCAACTTCCAAGAGTCGACGTCTGGCGGCAGTCGCAAGGGTCGACCCGCGGCCAGC
CTCCCTCCTCCGGTTACGGCGCCAACATCGTCTCCGTCGTCGAAGCGCTTCCTCTGGACCATGTCCTTCTACGCG
CAGTTCTTCGATGTCGACACGTCAGCGGTGCTGTCGCGGTGCTGGGCTGCGCTCTTCCCGCGGGCTAACTTTCTC
GACGTGCTCGAGGGCAATGCCGACCTCTACGGGCCATTTTGGATCGCTACGACAGTCGTCCTCATCTTGTTCTTG
GGCGGCACTATAAGTCAGTACCTCTCGACGACGAGGTCTACGCCGTTTGCGTACGATTTTAGGCTTCTAAGCGGA
GCTGCTGGACTCGTGTACGGATATACACTCTTCCTCCCTGTACTCCTGTTCCTCGCCCTCCGATACTTTGGCAGC
GAGTTGGCCAACCTCCTGGAATGCTGGGCGCTGTACGGCTACTCCAATCTCATCTGGATCCCGGTGGCCATCATC
AGCTGGTCGCCGTTGGAGGTGCTCAACTGGGTTTTTGTCGCCGTCGGCTTCAGCATGTCCGTCGCCTTCCTCGTC
CGCAACCTGTACCCCGTGTTGAGCGCGACGGACAAGCAGATCAGCAAGGTGCTGCTGATTCTCGTCGTCATGCTC
CACGCCGGCCTGTCGCTCACCATCAAGATCCTGTTCTTCGCTCACGGCAGCCCGGTCGCGAGGGCTCCTGGGCAG
GGCGGCCCGGGAAAACCGACGGGCGACGACAAGACGGCAGGAAGGTTTTAG
Gene >Ophio5|2405
ATGTCCGGGTCCGGGTACGACGCAGTGGTGGACGTGGATGACGAGGTAGATGCTGCCTTTCCCTTACTTTCCCGC
CAGGGCAACGAAGCTGATGACCCATCTTTCCCCGTCTACGTATGCAGGGTGACCTTGGACACACGGATCTTCAGG
AGGATCTCGAATTCCACAACTCCAACTTCCAAGAGTCGACGTCTGGCGGCAGTCGCAAGGGTCGACCCGCGGCCA
GCCTCCCTCCTCCGGTTACGGCGCCAACATCGTCTCCGTCGTCGAAGCGCTTCCTCTGGACCATGTCCTTCTACG
CGCAGTTCTTCGATGTCGACACGTCAGCGGTGCTGTCGCGGTGCTGGGCTGCGCTCTTCCCGCGGGCTAACTTTC
TCGACGTGCTCGAGGGCAATGCCGACCTCTACGGGCCATTTTGGATCGCTACGACAGTCGTCCTCATCTTGTTCT
TGGGCGGCACTATAAGTCAGTACCTCTCGACGACGAGGTCTACGCCGTTTGCGTACGATTTTAGGCTTCTAAGCG
GTAAGGGCCCTACCAACGTTTGCCGCAAGCCAAAAGGCTGACGCGCATCTATCTACCAGGAGCTGCTGGACTCGT
GTACGGATATACACTCTTCCTCCCTGTACTCCTGTTCCTCGCCCTCCGATACTTTGGCAGCGAGTTGGCCAACCT
CCTGGAATGCTGGGCGCTGTACGGCTACTCCAATCTCATCTGGATCCCGGTGGCCATCATCAGCTGGTCGCCGTT
GGAGGTGCTCAACTGGGTTTTTGTCGCCGTCGGCTTCAGCATGTCCGTCGCCTTCCTCGTCCGCAACCTGTACCC
CGTGTTGAGCGCGACGGACAAGCAGATCAGCAAGGTGCTGCTGATTCTCGTCGTCATGCTCCACGCCGGCCTGTC
GCTCACCATCAAGATCCTGTTCTTCGCTCACGGCAGCCCGGTCGCGAGGGCTCCTGGGCAGGGCGGCCCGGGAAA
ACCGACGGGCGACGACAAGACGGCAGGAAGGTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail