Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2404
Gene name
Locationscaffold_20:70037..70899
Strand+
Gene length (bp)862
Transcript length (bp)729
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00581 Rhodanese Rhodanese-like domain 1.9E-11 113 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22978|HS6B_DROME Heat shock protein 67B2 OS=Drosophila melanogaster GN=Hsp67Bb PE=2 SV=1 113 211 9.0E-17
sp|Q10215|RDL_SCHPO Putative thiosulfate sulfurtransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.07c PE=3 SV=2 110 207 9.0E-17
sp|Q9D0B5|TSTD3_MOUSE Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 OS=Mus musculus GN=Tstd3 PE=1 SV=1 112 206 1.0E-13
sp|Q08742|RDL2_YEAST Thiosulfate sulfurtransferase RDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDL2 PE=1 SV=1 116 211 2.0E-13
sp|Q12305|RDL1_YEAST Thiosulfate sulfurtransferase RDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDL1 PE=1 SV=1 107 211 8.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22978|HS6B_DROME Heat shock protein 67B2 OS=Drosophila melanogaster GN=Hsp67Bb PE=2 SV=1 113 211 9.0E-17
sp|Q10215|RDL_SCHPO Putative thiosulfate sulfurtransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.07c PE=3 SV=2 110 207 9.0E-17
sp|Q9D0B5|TSTD3_MOUSE Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 OS=Mus musculus GN=Tstd3 PE=1 SV=1 112 206 1.0E-13
sp|Q08742|RDL2_YEAST Thiosulfate sulfurtransferase RDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDL2 PE=1 SV=1 116 211 2.0E-13
sp|Q12305|RDL1_YEAST Thiosulfate sulfurtransferase RDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDL1 PE=1 SV=1 107 211 8.0E-09
sp|Q8NFU3|TSTD1_HUMAN Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1 OS=Homo sapiens GN=TSTD1 PE=1 SV=3 116 206 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2404
MTPAGRALLLLRRRAIVTATNKASLPAAASHIKLLVDANPNPNPHQPPHQHAGHRKPVRWLSSEWGKLPASTPPS
RIWSFEEVCDRLEEGDSVGPDSDGEKRSPPSRVEGEEDVYFVDVREKHELVKTGKIPGAINIPMSKAVEGRGCWR
IGDNAFEENYGFRRPPRNAHVVFYCRAGVRAHAAAVMASEAGWKSVGEYPGSWLDWSKCGGTAERVFTDIDENKR
WRPFVNDGNDEGDPRES
Coding >Ophio5|2404
ATGACACCGGCTGGTCGCGCCCTGCTGCTCCTGCGGCGACGAGCCATCGTCACGGCCACGAACAAGGCGTCACTC
CCCGCGGCCGCGAGCCACATCAAGCTCTTGGTCGATGCCAATCCTAATCCTAATCCTCATCAACCTCCACATCAA
CATGCAGGCCACAGAAAGCCGGTGCGCTGGCTCTCGAGCGAATGGGGCAAACTACCGGCGTCGACGCCCCCCTCG
CGCATCTGGAGCTTCGAAGAGGTCTGTGACCGGCTCGAGGAGGGCGATAGCGTCGGTCCCGATTCCGATGGAGAG
AAAAGGTCGCCGCCCTCTAGGGTCGAGGGCGAAGAGGACGTCTACTTTGTTGACGTCCGCGAGAAGCACGAACTC
GTCAAAACGGGTAAAATCCCCGGCGCCATCAACATCCCCATGTCCAAGGCCGTCGAGGGCCGCGGCTGCTGGCGC
ATCGGGGACAACGCCTTCGAGGAGAATTACGGCTTTCGTCGCCCGCCCCGAAACGCCCACGTCGTCTTCTACTGC
CGCGCCGGCGTCCGCGCTCACGCCGCTGCAGTCATGGCCTCTGAGGCCGGCTGGAAATCCGTTGGCGAGTACCCT
GGCAGCTGGCTTGACTGGAGCAAATGCGGAGGCACCGCCGAGAGGGTCTTCACCGACATCGACGAAAATAAACGT
TGGCGGCCCTTTGTAAACGACGGCAATGACGAGGGGGATCCTAGGGAGAGC
Transcript >Ophio5|2404
ATGACACCGGCTGGTCGCGCCCTGCTGCTCCTGCGGCGACGAGCCATCGTCACGGCCACGAACAAGGCGTCACTC
CCCGCGGCCGCGAGCCACATCAAGCTCTTGGTCGATGCCAATCCTAATCCTAATCCTCATCAACCTCCACATCAA
CATGCAGGCCACAGAAAGCCGGTGCGCTGGCTCTCGAGCGAATGGGGCAAACTACCGGCGTCGACGCCCCCCTCG
CGCATCTGGAGCTTCGAAGAGGTCTGTGACCGGCTCGAGGAGGGCGATAGCGTCGGTCCCGATTCCGATGGAGAG
AAAAGGTCGCCGCCCTCTAGGGTCGAGGGCGAAGAGGACGTCTACTTTGTTGACGTCCGCGAGAAGCACGAACTC
GTCAAAACGGGTAAAATCCCCGGCGCCATCAACATCCCCATGTCCAAGGCCGTCGAGGGCCGCGGCTGCTGGCGC
ATCGGGGACAACGCCTTCGAGGAGAATTACGGCTTTCGTCGCCCGCCCCGAAACGCCCACGTCGTCTTCTACTGC
CGCGCCGGCGTCCGCGCTCACGCCGCTGCAGTCATGGCCTCTGAGGCCGGCTGGAAATCCGTTGGCGAGTACCCT
GGCAGCTGGCTTGACTGGAGCAAATGCGGAGGCACCGCCGAGAGGGTCTTCACCGACATCGACGAAAATAAACGT
TGGCGGCCCTTTGTAAACGACGGCAATGACGAGGGGGATCCTAGGGAGAGCTAG
Gene >Ophio5|2404
ATGACACCGGCTGGTCGCGCCCTGCTGCTCCTGCGGCGACGAGCCATCGTCACGGCCACGAACAAGGCGTCACTC
CCCGCGGCCGCGAGCCACATCAAGCTCTTGGTCGATGCCAATCCTAATCCTAATCCTCATCAACCTCCACATCAA
CATGCAGGCCACAGAAAGCCGGTGCGCTGGCTCTCGAGCGAATGGGGCAAACTACCGGCGTCGACGCCCCCCTCG
CGCATCTGGAGCTTCGAAGAGGTCTGTGACCGGCTCGAGGAGGGCGATAGCGTCGGTCCCGATTCCGATGGAGAG
AAAAGGTCGCCGCCCTCTAGGGTCGAGGGCGAAGAGGACGTCTACTTTGTTGGTATGGTTGGACCCGAGCCGGTC
TTCTTCCCCTTTCCCGCCTGCTTTTTTTTCTCCTTGACGAACTCTACTAAGAAAGGGCGCGGCCCGGGTTGGGGA
GGGGGATGGGAAAATCCACGCTTACACACGCAAAGACGTCCGCGAGAAGCACGAACTCGTCAAAACGGGTAAAAT
CCCCGGCGCCATCAACATCCCCATGTCCAAGGCCGTCGAGGGCCGCGGCTGCTGGCGCATCGGGGACAACGCCTT
CGAGGAGAATTACGGCTTTCGTCGCCCGCCCCGAAACGCCCACGTCGTCTTCTACTGCCGCGCCGGCGTCCGCGC
TCACGCCGCTGCAGTCATGGCCTCTGAGGCCGGCTGGAAATCCGTTGGCGAGTACCCTGGCAGCTGGCTTGACTG
GAGCAAATGCGGAGGCACCGCCGAGAGGGTCTTCACCGACATCGACGAAAATAAACGTTGGCGGCCCTTTGTAAA
CGACGGCAATGACGAGGGGGATCCTAGGGAGAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail