Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2398
Gene name
Locationscaffold_20:45723..47898
Strand+
Gene length (bp)2175
Transcript length (bp)2175
Coding sequence length (bp)2172
Protein length (aa) 724

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16201 NopRA1 Nucleolar pre-ribosomal-associated protein 1 2.6E-58 460 651

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74415|YJL2_SCHPO Uncharacterized protein C14G10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC14G10.02 PE=4 SV=1 3 330 2.0E-18
sp|P34241|URB1_YEAST Nucleolar pre-ribosomal-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URB1 PE=1 SV=2 3 360 4.0E-14
sp|P34241|URB1_YEAST Nucleolar pre-ribosomal-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URB1 PE=1 SV=2 488 654 5.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5758 0.5643 0.1348 0.0844 0.1778 0.0266 0.3794 0.2513 0.413 0.0183

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1143
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6771
Ophiocordyceps australis map64 (Brazil) OphauB2|7315
Ophiocordyceps camponoti-floridani Ophcf2|04234
Ophiocordyceps camponoti-rufipedis Ophun1|1503
Ophiocordyceps kimflemingae Ophio5|2398 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10211
Ophiocordyceps subramaniannii Hirsu2|10212

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2398
MTWVGYAAFLFDTISIPLPPSFGDPVRYADAPPPTLVLLDNILPPAVTQKVLVRCFSLKSDVTALFATKILVAAL
EKLATALKMHGSTQGCETAKWSEAARRLEDVFCQRVPEMKDIVQCYRGIPAENSMHKTLVSRLLLLYYRVIPRVA
LAANFDVSPLLSAVLQGLRQGESEPGVRKLSLIELESLVTIASYSPGMRWFSRPEGPRHESSTSAFVALLQLLCG
GDGDTPFGHLREALASVAVEGQLVSETTGLIPLLAALQLTVGQIDTGDMEVVWDFLDNCIGRCVASPIKYIEMME
TLLAEQTDTSPAEDSSPSLLSLALVEQLPFAANSGEKRGLQPHALFLSLYFNACYLWEGHRHLLGALHRQLCRHL
SSSKAKMVALGNESDMTALKAIESDVNRGQGSSRVTDGRQHAPGELALHQDLHVSPLDEGDATVLTKWISKRVED
VIEDGWAVKLVRLLLSEHTHIRKEALTSILKLAARLKDSSHEDYSQIWLLLSELAESCRTQVESGPVPSAFAAFV
MHALEVLQNPLHPLYPKLNRYLTRSPVWPPDKLPLAHDILHGEPSEDDKYYTEIGWLLAYVLDSLRTQRDLNVLH
GKKWFEKLLALGCNPYLRAGLRTRLLKIVYRATCIEAGSTTLVTRFGILSWLDAQRAACDSTDEAAVCQGLMCRV
WHTCHQHRVSAWSHGGAQKLVDRAARQTSTDASRPVCPDAPSHGGTASI
Coding >Ophio5|2398
ATGACATGGGTTGGATACGCCGCTTTTCTTTTCGACACCATCAGCATTCCGCTTCCTCCTTCGTTCGGGGACCCT
GTGCGCTACGCTGACGCACCTCCTCCTACCCTTGTTCTACTGGACAACATCCTCCCCCCCGCCGTTACTCAAAAA
GTCCTCGTTCGTTGTTTTTCGCTCAAGTCGGACGTGACGGCCCTCTTCGCCACCAAGATTCTCGTGGCCGCTCTG
GAGAAGCTTGCTACAGCGCTCAAGATGCATGGTTCGACTCAAGGTTGCGAGACCGCCAAGTGGTCGGAAGCTGCC
CGACGGCTCGAGGATGTTTTCTGCCAGCGGGTGCCCGAAATGAAGGACATCGTTCAGTGCTACAGGGGGATCCCC
GCAGAGAACTCGATGCACAAGACGTTGGTGAGCCGTTTGTTGCTGCTCTACTACAGAGTGATTCCTCGAGTCGCT
CTGGCCGCCAACTTTGATGTCTCGCCCTTGCTGTCGGCTGTCCTGCAAGGTCTGCGGCAGGGAGAGTCCGAGCCT
GGCGTCCGAAAACTCAGCCTGATTGAGCTGGAGAGTCTCGTGACCATAGCCAGTTACTCGCCCGGTATGAGATGG
TTCTCCAGACCGGAAGGCCCACGTCATGAATCGTCAACCTCGGCTTTCGTCGCACTGCTTCAGCTCCTTTGTGGC
GGCGACGGCGATACCCCCTTTGGTCATCTCAGAGAAGCGCTAGCCAGCGTTGCCGTGGAGGGCCAACTTGTCTCC
GAGACTACCGGATTGATACCCTTACTTGCCGCTCTGCAGCTCACCGTCGGTCAGATTGACACGGGGGATATGGAA
GTAGTTTGGGACTTCTTGGACAACTGTATAGGCCGCTGCGTCGCCTCTCCGATCAAGTACATTGAGATGATGGAA
ACCCTGTTGGCTGAACAGACTGATACTTCACCGGCGGAGGACAGCTCACCGTCACTGCTGAGCCTCGCATTGGTC
GAGCAGCTACCGTTTGCCGCTAACTCGGGCGAGAAGAGGGGATTGCAGCCTCATGCGCTGTTTCTCTCACTTTAC
TTCAATGCCTGTTACTTATGGGAGGGTCATCGTCATCTACTCGGGGCGCTTCATCGACAACTCTGCCGTCATTTG
TCATCTAGCAAAGCCAAGATGGTTGCCTTGGGTAACGAGAGCGACATGACGGCGCTGAAAGCGATTGAGTCTGAT
GTGAATCGGGGTCAGGGCTCCTCCCGCGTGACGGATGGACGGCAACATGCCCCGGGCGAGCTGGCTTTACACCAA
GACTTGCACGTTTCCCCCTTGGACGAAGGGGACGCGACGGTCCTCACCAAATGGATCTCAAAAAGAGTTGAAGAC
GTGATAGAGGACGGATGGGCGGTGAAGCTGGTACGGCTCCTCTTGTCGGAGCACACGCACATACGCAAAGAGGCC
CTCACGAGCATACTGAAACTGGCTGCCCGCCTGAAAGACTCGTCGCACGAGGACTACTCCCAGATCTGGCTGCTA
CTGTCAGAGCTTGCCGAGTCTTGCAGGACGCAGGTCGAGTCGGGTCCTGTCCCATCAGCCTTTGCGGCCTTCGTC
ATGCACGCGCTGGAAGTGTTGCAAAATCCGCTGCATCCTCTGTATCCGAAACTGAACCGCTATCTCACCCGCAGC
CCTGTCTGGCCGCCGGACAAGTTGCCGCTCGCTCACGACATCCTCCACGGGGAGCCGTCGGAAGACGACAAGTAC
TACACTGAAATCGGCTGGCTCCTAGCCTATGTCCTCGATAGTCTGCGGACGCAGCGCGACCTCAACGTCTTGCAC
GGCAAGAAATGGTTCGAGAAGCTCCTCGCGTTGGGCTGCAACCCGTACCTCAGGGCCGGCCTGCGCACCAGGCTC
CTCAAGATTGTTTACCGAGCCACGTGCATCGAGGCCGGCAGCACCACCCTCGTCACCAGATTCGGCATTCTCAGC
TGGCTCGACGCTCAGCGAGCGGCCTGCGATTCGACTGACGAGGCTGCCGTTTGCCAAGGCCTGATGTGCCGCGTC
TGGCACACCTGTCATCAGCACCGCGTTTCTGCCTGGAGCCATGGCGGAGCGCAGAAACTCGTCGACCGAGCTGCC
CGTCAGACGTCGACAGACGCTTCCCGACCCGTGTGTCCTGACGCTCCGTCGCATGGAGGCACTGCCTCGATA
Transcript >Ophio5|2398
ATGACATGGGTTGGATACGCCGCTTTTCTTTTCGACACCATCAGCATTCCGCTTCCTCCTTCGTTCGGGGACCCT
GTGCGCTACGCTGACGCACCTCCTCCTACCCTTGTTCTACTGGACAACATCCTCCCCCCCGCCGTTACTCAAAAA
GTCCTCGTTCGTTGTTTTTCGCTCAAGTCGGACGTGACGGCCCTCTTCGCCACCAAGATTCTCGTGGCCGCTCTG
GAGAAGCTTGCTACAGCGCTCAAGATGCATGGTTCGACTCAAGGTTGCGAGACCGCCAAGTGGTCGGAAGCTGCC
CGACGGCTCGAGGATGTTTTCTGCCAGCGGGTGCCCGAAATGAAGGACATCGTTCAGTGCTACAGGGGGATCCCC
GCAGAGAACTCGATGCACAAGACGTTGGTGAGCCGTTTGTTGCTGCTCTACTACAGAGTGATTCCTCGAGTCGCT
CTGGCCGCCAACTTTGATGTCTCGCCCTTGCTGTCGGCTGTCCTGCAAGGTCTGCGGCAGGGAGAGTCCGAGCCT
GGCGTCCGAAAACTCAGCCTGATTGAGCTGGAGAGTCTCGTGACCATAGCCAGTTACTCGCCCGGTATGAGATGG
TTCTCCAGACCGGAAGGCCCACGTCATGAATCGTCAACCTCGGCTTTCGTCGCACTGCTTCAGCTCCTTTGTGGC
GGCGACGGCGATACCCCCTTTGGTCATCTCAGAGAAGCGCTAGCCAGCGTTGCCGTGGAGGGCCAACTTGTCTCC
GAGACTACCGGATTGATACCCTTACTTGCCGCTCTGCAGCTCACCGTCGGTCAGATTGACACGGGGGATATGGAA
GTAGTTTGGGACTTCTTGGACAACTGTATAGGCCGCTGCGTCGCCTCTCCGATCAAGTACATTGAGATGATGGAA
ACCCTGTTGGCTGAACAGACTGATACTTCACCGGCGGAGGACAGCTCACCGTCACTGCTGAGCCTCGCATTGGTC
GAGCAGCTACCGTTTGCCGCTAACTCGGGCGAGAAGAGGGGATTGCAGCCTCATGCGCTGTTTCTCTCACTTTAC
TTCAATGCCTGTTACTTATGGGAGGGTCATCGTCATCTACTCGGGGCGCTTCATCGACAACTCTGCCGTCATTTG
TCATCTAGCAAAGCCAAGATGGTTGCCTTGGGTAACGAGAGCGACATGACGGCGCTGAAAGCGATTGAGTCTGAT
GTGAATCGGGGTCAGGGCTCCTCCCGCGTGACGGATGGACGGCAACATGCCCCGGGCGAGCTGGCTTTACACCAA
GACTTGCACGTTTCCCCCTTGGACGAAGGGGACGCGACGGTCCTCACCAAATGGATCTCAAAAAGAGTTGAAGAC
GTGATAGAGGACGGATGGGCGGTGAAGCTGGTACGGCTCCTCTTGTCGGAGCACACGCACATACGCAAAGAGGCC
CTCACGAGCATACTGAAACTGGCTGCCCGCCTGAAAGACTCGTCGCACGAGGACTACTCCCAGATCTGGCTGCTA
CTGTCAGAGCTTGCCGAGTCTTGCAGGACGCAGGTCGAGTCGGGTCCTGTCCCATCAGCCTTTGCGGCCTTCGTC
ATGCACGCGCTGGAAGTGTTGCAAAATCCGCTGCATCCTCTGTATCCGAAACTGAACCGCTATCTCACCCGCAGC
CCTGTCTGGCCGCCGGACAAGTTGCCGCTCGCTCACGACATCCTCCACGGGGAGCCGTCGGAAGACGACAAGTAC
TACACTGAAATCGGCTGGCTCCTAGCCTATGTCCTCGATAGTCTGCGGACGCAGCGCGACCTCAACGTCTTGCAC
GGCAAGAAATGGTTCGAGAAGCTCCTCGCGTTGGGCTGCAACCCGTACCTCAGGGCCGGCCTGCGCACCAGGCTC
CTCAAGATTGTTTACCGAGCCACGTGCATCGAGGCCGGCAGCACCACCCTCGTCACCAGATTCGGCATTCTCAGC
TGGCTCGACGCTCAGCGAGCGGCCTGCGATTCGACTGACGAGGCTGCCGTTTGCCAAGGCCTGATGTGCCGCGTC
TGGCACACCTGTCATCAGCACCGCGTTTCTGCCTGGAGCCATGGCGGAGCGCAGAAACTCGTCGACCGAGCTGCC
CGTCAGACGTCGACAGACGCTTCCCGACCCGTGTGTCCTGACGCTCCGTCGCATGGAGGCACTGCCTCGATATGA
Gene >Ophio5|2398
ATGACATGGGTTGGATACGCCGCTTTTCTTTTCGACACCATCAGCATTCCGCTTCCTCCTTCGTTCGGGGACCCT
GTGCGCTACGCTGACGCACCTCCTCCTACCCTTGTTCTACTGGACAACATCCTCCCCCCCGCCGTTACTCAAAAA
GTCCTCGTTCGTTGTTTTTCGCTCAAGTCGGACGTGACGGCCCTCTTCGCCACCAAGATTCTCGTGGCCGCTCTG
GAGAAGCTTGCTACAGCGCTCAAGATGCATGGTTCGACTCAAGGTTGCGAGACCGCCAAGTGGTCGGAAGCTGCC
CGACGGCTCGAGGATGTTTTCTGCCAGCGGGTGCCCGAAATGAAGGACATCGTTCAGTGCTACAGGGGGATCCCC
GCAGAGAACTCGATGCACAAGACGTTGGTGAGCCGTTTGTTGCTGCTCTACTACAGAGTGATTCCTCGAGTCGCT
CTGGCCGCCAACTTTGATGTCTCGCCCTTGCTGTCGGCTGTCCTGCAAGGTCTGCGGCAGGGAGAGTCCGAGCCT
GGCGTCCGAAAACTCAGCCTGATTGAGCTGGAGAGTCTCGTGACCATAGCCAGTTACTCGCCCGGTATGAGATGG
TTCTCCAGACCGGAAGGCCCACGTCATGAATCGTCAACCTCGGCTTTCGTCGCACTGCTTCAGCTCCTTTGTGGC
GGCGACGGCGATACCCCCTTTGGTCATCTCAGAGAAGCGCTAGCCAGCGTTGCCGTGGAGGGCCAACTTGTCTCC
GAGACTACCGGATTGATACCCTTACTTGCCGCTCTGCAGCTCACCGTCGGTCAGATTGACACGGGGGATATGGAA
GTAGTTTGGGACTTCTTGGACAACTGTATAGGCCGCTGCGTCGCCTCTCCGATCAAGTACATTGAGATGATGGAA
ACCCTGTTGGCTGAACAGACTGATACTTCACCGGCGGAGGACAGCTCACCGTCACTGCTGAGCCTCGCATTGGTC
GAGCAGCTACCGTTTGCCGCTAACTCGGGCGAGAAGAGGGGATTGCAGCCTCATGCGCTGTTTCTCTCACTTTAC
TTCAATGCCTGTTACTTATGGGAGGGTCATCGTCATCTACTCGGGGCGCTTCATCGACAACTCTGCCGTCATTTG
TCATCTAGCAAAGCCAAGATGGTTGCCTTGGGTAACGAGAGCGACATGACGGCGCTGAAAGCGATTGAGTCTGAT
GTGAATCGGGGTCAGGGCTCCTCCCGCGTGACGGATGGACGGCAACATGCCCCGGGCGAGCTGGCTTTACACCAA
GACTTGCACGTTTCCCCCTTGGACGAAGGGGACGCGACGGTCCTCACCAAATGGATCTCAAAAAGAGTTGAAGAC
GTGATAGAGGACGGATGGGCGGTGAAGCTGGTACGGCTCCTCTTGTCGGAGCACACGCACATACGCAAAGAGGCC
CTCACGAGCATACTGAAACTGGCTGCCCGCCTGAAAGACTCGTCGCACGAGGACTACTCCCAGATCTGGCTGCTA
CTGTCAGAGCTTGCCGAGTCTTGCAGGACGCAGGTCGAGTCGGGTCCTGTCCCATCAGCCTTTGCGGCCTTCGTC
ATGCACGCGCTGGAAGTGTTGCAAAATCCGCTGCATCCTCTGTATCCGAAACTGAACCGCTATCTCACCCGCAGC
CCTGTCTGGCCGCCGGACAAGTTGCCGCTCGCTCACGACATCCTCCACGGGGAGCCGTCGGAAGACGACAAGTAC
TACACTGAAATCGGCTGGCTCCTAGCCTATGTCCTCGATAGTCTGCGGACGCAGCGCGACCTCAACGTCTTGCAC
GGCAAGAAATGGTTCGAGAAGCTCCTCGCGTTGGGCTGCAACCCGTACCTCAGGGCCGGCCTGCGCACCAGGCTC
CTCAAGATTGTTTACCGAGCCACGTGCATCGAGGCCGGCAGCACCACCCTCGTCACCAGATTCGGCATTCTCAGC
TGGCTCGACGCTCAGCGAGCGGCCTGCGATTCGACTGACGAGGCTGCCGTTTGCCAAGGCCTGATGTGCCGCGTC
TGGCACACCTGTCATCAGCACCGCGTTTCTGCCTGGAGCCATGGCGGAGCGCAGAAACTCGTCGACCGAGCTGCC
CGTCAGACGTCGACAGACGCTTCCCGACCCGTGTGTCCTGACGCTCCGTCGCATGGAGGCACTGCCTCGATATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail