Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2396
Gene name
Locationscaffold_20:40040..41514
Strand+
Gene length (bp)1474
Transcript length (bp)1398
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00328 His_Phos_2 Histidine phosphatase superfamily (branch 2) 2.7E-61 64 423

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O00107|PHYA_THIHE 3-phytase A OS=Thielavia heterothallica GN=PHYA PE=1 SV=1 2 463 1.0E-155
sp|Q9C1T1|PHYA_ASPOR 3-phytase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=phyA PE=2 SV=1 1 463 9.0E-147
sp|O00093|PHYB_EMENI 3-phytase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=phyB PE=3 SV=2 24 462 1.0E-135
sp|O00092|PHYA_ASPFU 3-phytase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=phyA PE=1 SV=1 21 463 1.0E-132
sp|P34753|PHYA_ASPAW 3-phytase A OS=Aspergillus awamori GN=phyA PE=3 SV=1 24 463 1.0E-131
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O00107|PHYA_THIHE 3-phytase A OS=Thielavia heterothallica GN=PHYA PE=1 SV=1 2 463 1.0E-155
sp|Q9C1T1|PHYA_ASPOR 3-phytase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=phyA PE=2 SV=1 1 463 9.0E-147
sp|O00093|PHYB_EMENI 3-phytase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=phyB PE=3 SV=2 24 462 1.0E-135
sp|O00092|PHYA_ASPFU 3-phytase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=phyA PE=1 SV=1 21 463 1.0E-132
sp|P34753|PHYA_ASPAW 3-phytase A OS=Aspergillus awamori GN=phyA PE=3 SV=1 24 463 1.0E-131
sp|P34752|PHYA_ASPNG 3-phytase A OS=Aspergillus niger GN=phyA PE=1 SV=1 24 463 2.0E-131
sp|D4ANW6|PHYA_ARTBC 3-phytase A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05933 PE=1 SV=1 1 461 4.0E-129
sp|Q0CLV1|PHYA_ASPTN 3-phytase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=phyA PE=3 SV=1 1 462 4.0E-123
sp|O00100|PHYA2_ASPTE 3-phytase A OS=Aspergillus terreus GN=phyA PE=1 SV=1 1 462 3.0E-121
sp|O00085|PHYA1_ASPTE 3-phytase A OS=Aspergillus terreus GN=phyA PE=1 SV=1 24 462 7.0E-120
sp|P52291|PPA1_PICPA Acid phosphatase PHO1 OS=Komagataella pastoris GN=PHO1 PE=2 SV=1 49 449 5.0E-29
sp|P08091|PPA1_SCHPO Acid phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pho1 PE=2 SV=1 58 448 1.0E-25
sp|Q01682|PPA2_SCHPO Thiamine-repressible acid phosphatase pho4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pho4 PE=1 SV=1 43 448 2.0E-25
sp|P52290|PPAD_YEAST Probable acid phosphatase DIA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIA3 PE=3 SV=1 6 434 4.0E-25
sp|P35842|PPAB_YEAST Acid phosphatase PHO11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO11 PE=1 SV=1 48 445 4.0E-25
sp|P38693|PPAC_YEAST Acid phosphatase PHO12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO12 PE=1 SV=1 48 445 5.0E-25
sp|O60172|PPA3_SCHPO Thiamine-repressible acid phosphatase SPBC21H7.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21H7.03c PE=2 SV=1 44 448 3.0E-24
sp|P00635|PPA5_YEAST Repressible acid phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO5 PE=1 SV=2 48 445 1.0E-23
sp|P52289|PPA5_KLULA Repressible acid phosphatase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PHO5 PE=3 SV=2 57 450 3.0E-23
sp|P34755|PHYB_ASPAW 3-phytase B OS=Aspergillus awamori GN=phyB PE=1 SV=1 58 449 6.0E-20
sp|P34754|PHYB_ASPNG 3-phytase B OS=Aspergillus niger GN=phyB PE=1 SV=1 58 449 1.0E-19
sp|P24031|PPA3_YEAST Constitutive acid phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO3 PE=1 SV=2 48 445 2.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2396
MLATLLALVVVLGQKLLNTLSPPCAAPDKKYLAPSASLEWAQYSPFAPAPSSLDSATPDGCRLTFGLVLSRHGSR
FPTRRMAEEEYAPLFRHIRRSVTDFGPGFDFVRDFEPDLRTDELSPLGQREMVDSGKAFYTRYGDLASSSEPFVR
ASGSDRVIMSAQNFTLGFSAAQGRDPTGALAGILVIPEQEGVNNTLDHQLCTAFEDGPAADVGADKQKPWKKKWA
TPIMERLNDNLPGANLTLDQAVYMMDQCPFNSVVEPDAPMSDFCRLFSRDEWYGYGYYHSLGKWYAYGNGNPLGP
TQGVGYVNELVARLTGRPVRDDTSTNSTLDADPKTFPLDRTLYADFSHDNTLTSVYAALGLYNATDDLPTTHRLS
PSEANGYSAAWTVPFAARMYVEKMRCGHSSGDGDDNDEEKELVRILVNDRVVPLQGCGADELGRCTLDDFVNSLT
FAGAGGRWNTCFAKA
Coding >Ophio5|2396
ATGCTCGCCACCCTCCTAGCGCTTGTCGTCGTCTTGGGGCAGAAGCTCCTCAACACGCTGTCGCCGCCATGCGCC
GCTCCGGACAAGAAATACCTCGCCCCGTCGGCGTCGCTCGAATGGGCTCAGTACTCGCCCTTCGCTCCGGCGCCT
TCGTCCCTTGATTCGGCCACACCTGATGGTTGTCGGTTGACGTTTGGTCTCGTCTTGTCACGGCATGGCTCGCGC
TTTCCGACTCGGCGCATGGCAGAGGAGGAATACGCGCCCTTGTTCCGGCACATACGGCGCTCTGTCACCGACTTC
GGTCCGGGTTTCGACTTCGTCCGCGACTTTGAGCCGGACCTACGCACAGATGAGCTATCCCCTCTCGGACAGCGA
GAGATGGTCGACTCGGGAAAGGCCTTTTACACTCGCTACGGGGACCTGGCGTCCTCGTCCGAACCCTTCGTCCGT
GCCTCCGGTTCGGACCGGGTCATCATGTCGGCCCAGAACTTCACTCTGGGCTTCTCCGCCGCCCAGGGCAGAGAC
CCAACCGGCGCATTGGCCGGCATCCTCGTCATTCCCGAGCAAGAGGGCGTCAACAACACTCTCGACCACCAGCTT
TGCACCGCCTTCGAAGATGGCCCCGCCGCAGACGTCGGCGCAGACAAGCAGAAGCCGTGGAAGAAGAAGTGGGCG
ACGCCCATCATGGAAAGACTCAACGACAACCTCCCCGGCGCGAACCTGACGCTCGACCAGGCCGTTTACATGATG
GACCAATGCCCCTTCAACAGCGTCGTCGAACCAGATGCTCCCATGTCCGACTTTTGCCGCCTCTTCTCGCGCGAC
GAGTGGTACGGCTACGGCTATTACCATTCGCTTGGCAAATGGTACGCCTACGGCAACGGGAACCCTCTGGGCCCG
ACGCAGGGGGTGGGCTACGTCAACGAGCTCGTCGCCCGTCTAACCGGACGCCCTGTCCGAGACGATACCAGCACC
AACTCGACGCTCGATGCCGATCCCAAGACCTTCCCGCTCGACCGCACGCTCTACGCCGACTTCAGCCACGACAAC
ACCTTGACGTCCGTTTACGCCGCGCTCGGGCTGTACAACGCCACGGATGATCTGCCCACAACGCACAGGCTGTCA
CCCAGCGAGGCAAACGGCTACTCTGCCGCCTGGACGGTCCCTTTTGCCGCTCGTATGTACGTCGAGAAGATGCGC
TGCGGGCACAGCAGCGGCGACGGCGACGACAACGACGAGGAGAAGGAGCTGGTGAGAATCCTTGTCAACGACCGC
GTCGTGCCGCTGCAAGGTTGCGGCGCTGACGAACTGGGACGTTGCACTCTGGACGACTTCGTGAACAGCCTCACA
TTTGCCGGAGCTGGCGGTCGGTGGAACACATGCTTTGCTAAGGCC
Transcript >Ophio5|2396
ATGCTCGCCACCCTCCTAGCGCTTGTCGTCGTCTTGGGGCAGAAGCTCCTCAACACGCTGTCGCCGCCATGCGCC
GCTCCGGACAAGAAATACCTCGCCCCGTCGGCGTCGCTCGAATGGGCTCAGTACTCGCCCTTCGCTCCGGCGCCT
TCGTCCCTTGATTCGGCCACACCTGATGGTTGTCGGTTGACGTTTGGTCTCGTCTTGTCACGGCATGGCTCGCGC
TTTCCGACTCGGCGCATGGCAGAGGAGGAATACGCGCCCTTGTTCCGGCACATACGGCGCTCTGTCACCGACTTC
GGTCCGGGTTTCGACTTCGTCCGCGACTTTGAGCCGGACCTACGCACAGATGAGCTATCCCCTCTCGGACAGCGA
GAGATGGTCGACTCGGGAAAGGCCTTTTACACTCGCTACGGGGACCTGGCGTCCTCGTCCGAACCCTTCGTCCGT
GCCTCCGGTTCGGACCGGGTCATCATGTCGGCCCAGAACTTCACTCTGGGCTTCTCCGCCGCCCAGGGCAGAGAC
CCAACCGGCGCATTGGCCGGCATCCTCGTCATTCCCGAGCAAGAGGGCGTCAACAACACTCTCGACCACCAGCTT
TGCACCGCCTTCGAAGATGGCCCCGCCGCAGACGTCGGCGCAGACAAGCAGAAGCCGTGGAAGAAGAAGTGGGCG
ACGCCCATCATGGAAAGACTCAACGACAACCTCCCCGGCGCGAACCTGACGCTCGACCAGGCCGTTTACATGATG
GACCAATGCCCCTTCAACAGCGTCGTCGAACCAGATGCTCCCATGTCCGACTTTTGCCGCCTCTTCTCGCGCGAC
GAGTGGTACGGCTACGGCTATTACCATTCGCTTGGCAAATGGTACGCCTACGGCAACGGGAACCCTCTGGGCCCG
ACGCAGGGGGTGGGCTACGTCAACGAGCTCGTCGCCCGTCTAACCGGACGCCCTGTCCGAGACGATACCAGCACC
AACTCGACGCTCGATGCCGATCCCAAGACCTTCCCGCTCGACCGCACGCTCTACGCCGACTTCAGCCACGACAAC
ACCTTGACGTCCGTTTACGCCGCGCTCGGGCTGTACAACGCCACGGATGATCTGCCCACAACGCACAGGCTGTCA
CCCAGCGAGGCAAACGGCTACTCTGCCGCCTGGACGGTCCCTTTTGCCGCTCGTATGTACGTCGAGAAGATGCGC
TGCGGGCACAGCAGCGGCGACGGCGACGACAACGACGAGGAGAAGGAGCTGGTGAGAATCCTTGTCAACGACCGC
GTCGTGCCGCTGCAAGGTTGCGGCGCTGACGAACTGGGACGTTGCACTCTGGACGACTTCGTGAACAGCCTCACA
TTTGCCGGAGCTGGCGGTCGGTGGAACACATGCTTTGCTAAGGCCTAG
Gene >Ophio5|2396
ATGCTCGCCACCCTCCTAGCGCTTGTCGTCGTCTTGGGGTACGCAAAACGCTCATACATACCTACCTATGCACGA
ATATGCGAGGGGGCGCTGACGGCCCGAACCTTAAACCAGGCAGAAGCTCCTCAACACGCTGTCGCCGCCATGCGC
CGCTCCGGACAAGAAATACCTCGCCCCGTCGGCGTCGCTCGAATGGGCTCAGTACTCGCCCTTCGCTCCGGCGCC
TTCGTCCCTTGATTCGGCCACACCTGATGGTTGTCGGTTGACGTTTGGTCTCGTCTTGTCACGGCATGGCTCGCG
CTTTCCGACTCGGCGCATGGCAGAGGAGGAATACGCGCCCTTGTTCCGGCACATACGGCGCTCTGTCACCGACTT
CGGTCCGGGTTTCGACTTCGTCCGCGACTTTGAGCCGGACCTACGCACAGATGAGCTATCCCCTCTCGGACAGCG
AGAGATGGTCGACTCGGGAAAGGCCTTTTACACTCGCTACGGGGACCTGGCGTCCTCGTCCGAACCCTTCGTCCG
TGCCTCCGGTTCGGACCGGGTCATCATGTCGGCCCAGAACTTCACTCTGGGCTTCTCCGCCGCCCAGGGCAGAGA
CCCAACCGGCGCATTGGCCGGCATCCTCGTCATTCCCGAGCAAGAGGGCGTCAACAACACTCTCGACCACCAGCT
TTGCACCGCCTTCGAAGATGGCCCCGCCGCAGACGTCGGCGCAGACAAGCAGAAGCCGTGGAAGAAGAAGTGGGC
GACGCCCATCATGGAAAGACTCAACGACAACCTCCCCGGCGCGAACCTGACGCTCGACCAGGCCGTTTACATGAT
GGACCAATGCCCCTTCAACAGCGTCGTCGAACCAGATGCTCCCATGTCCGACTTTTGCCGCCTCTTCTCGCGCGA
CGAGTGGTACGGCTACGGCTATTACCATTCGCTTGGCAAATGGTACGCCTACGGCAACGGGAACCCTCTGGGCCC
GACGCAGGGGGTGGGCTACGTCAACGAGCTCGTCGCCCGTCTAACCGGACGCCCTGTCCGAGACGATACCAGCAC
CAACTCGACGCTCGATGCCGATCCCAAGACCTTCCCGCTCGACCGCACGCTCTACGCCGACTTCAGCCACGACAA
CACCTTGACGTCCGTTTACGCCGCGCTCGGGCTGTACAACGCCACGGATGATCTGCCCACAACGCACAGGCTGTC
ACCCAGCGAGGCAAACGGCTACTCTGCCGCCTGGACGGTCCCTTTTGCCGCTCGTATGTACGTCGAGAAGATGCG
CTGCGGGCACAGCAGCGGCGACGGCGACGACAACGACGAGGAGAAGGAGCTGGTGAGAATCCTTGTCAACGACCG
CGTCGTGCCGCTGCAAGGTTGCGGCGCTGACGAACTGGGACGTTGCACTCTGGACGACTTCGTGAACAGCCTCAC
ATTTGCCGGAGCTGGCGGTCGGTGGAACACATGCTTTGCTAAGGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail