Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2384
Gene name
Locationscaffold_20:8314..11112
Strand-
Gene length (bp)2798
Transcript length (bp)2544
Coding sequence length (bp)2541
Protein length (aa) 847

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00614 PLDc Phospholipase D Active site motif 6.1E-07 208 233

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36126|SPO14_YEAST Phospholipase D1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO14 PE=1 SV=3 73 513 1.0E-101
sp|Q09706|PLD1_SCHPO Phospholipase D1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pld1 PE=1 SV=1 67 523 2.0E-101
sp|P97813|PLD2_MOUSE Phospholipase D2 OS=Mus musculus GN=Pld2 PE=1 SV=2 77 524 1.0E-82
sp|Q0V8L6|PLD2_BOVIN Phospholipase D2 OS=Bos taurus GN=PLD2 PE=2 SV=1 71 524 3.0E-81
sp|O14939|PLD2_HUMAN Phospholipase D2 OS=Homo sapiens GN=PLD2 PE=1 SV=2 71 524 2.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36126|SPO14_YEAST Phospholipase D1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO14 PE=1 SV=3 73 513 1.0E-101
sp|Q09706|PLD1_SCHPO Phospholipase D1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pld1 PE=1 SV=1 67 523 2.0E-101
sp|P97813|PLD2_MOUSE Phospholipase D2 OS=Mus musculus GN=Pld2 PE=1 SV=2 77 524 1.0E-82
sp|Q0V8L6|PLD2_BOVIN Phospholipase D2 OS=Bos taurus GN=PLD2 PE=2 SV=1 71 524 3.0E-81
sp|O14939|PLD2_HUMAN Phospholipase D2 OS=Homo sapiens GN=PLD2 PE=1 SV=2 71 524 2.0E-80
sp|P70498|PLD2_RAT Phospholipase D2 OS=Rattus norvegicus GN=Pld2 PE=1 SV=2 77 524 3.0E-79
sp|Q54UK0|PLDA_DICDI Phospholipase D A OS=Dictyostelium discoideum GN=pldA PE=2 SV=1 79 519 2.0E-66
sp|Q9M9W8|PLDZ2_ARATH Phospholipase D zeta 2 OS=Arabidopsis thaliana GN=PLPZETA2 PE=1 SV=2 73 329 4.0E-58
sp|Q9LRZ5|PLDZ1_ARATH Phospholipase D zeta 1 OS=Arabidopsis thaliana GN=PLDZETA1 PE=1 SV=1 70 318 7.0E-53
sp|Q5BMR2|PLD_PHYIN Phospholipase D OS=Phytophthora infestans GN=PLD PE=3 SV=1 80 329 4.0E-49
sp|Q13393|PLD1_HUMAN Phospholipase D1 OS=Homo sapiens GN=PLD1 PE=1 SV=1 67 244 8.0E-45
sp|Q9Z280|PLD1_MOUSE Phospholipase D1 OS=Mus musculus GN=Pld1 PE=2 SV=1 73 244 5.0E-44
sp|P70496|PLD1_RAT Phospholipase D1 OS=Rattus norvegicus GN=Pld1 PE=1 SV=3 67 261 9.0E-44
sp|O08684|PLD1_CRIGR Phospholipase D1 OS=Cricetulus griseus GN=PLD1 PE=2 SV=1 73 244 4.0E-40
sp|Q13393|PLD1_HUMAN Phospholipase D1 OS=Homo sapiens GN=PLD1 PE=1 SV=1 232 516 2.0E-39
sp|Q54Z25|PLDC_DICDI Phospholipase D C OS=Dictyostelium discoideum GN=pldC PE=3 SV=1 74 327 7.0E-39
sp|P70496|PLD1_RAT Phospholipase D1 OS=Rattus norvegicus GN=Pld1 PE=1 SV=3 232 516 1.0E-38
sp|Q54WR4|PLDB_DICDI Phospholipase D B OS=Dictyostelium discoideum GN=pldB PE=2 SV=1 74 312 4.0E-37
sp|O08684|PLD1_CRIGR Phospholipase D1 OS=Cricetulus griseus GN=PLD1 PE=2 SV=1 232 516 1.0E-36
sp|Q9Z280|PLD1_MOUSE Phospholipase D1 OS=Mus musculus GN=Pld1 PE=2 SV=1 254 516 1.0E-36
sp|Q5BMR2|PLD_PHYIN Phospholipase D OS=Phytophthora infestans GN=PLD PE=3 SV=1 336 524 3.0E-28
sp|Q9LRZ5|PLDZ1_ARATH Phospholipase D zeta 1 OS=Arabidopsis thaliana GN=PLDZETA1 PE=1 SV=1 359 526 1.0E-26
sp|Q9M9W8|PLDZ2_ARATH Phospholipase D zeta 2 OS=Arabidopsis thaliana GN=PLPZETA2 PE=1 SV=2 365 526 2.0E-26
sp|Q43007|PLDA1_ORYSJ Phospholipase D alpha 1 OS=Oryza sativa subsp. japonica GN=PLD1 PE=1 SV=2 77 539 3.0E-25
sp|O14939|PLD2_HUMAN Phospholipase D2 OS=Homo sapiens GN=PLD2 PE=1 SV=2 631 831 9.0E-25
sp|Q0V8L6|PLD2_BOVIN Phospholipase D2 OS=Bos taurus GN=PLD2 PE=2 SV=1 631 828 1.0E-24
sp|P70498|PLD2_RAT Phospholipase D2 OS=Rattus norvegicus GN=Pld2 PE=1 SV=2 631 842 2.0E-24
sp|Q70EW5|PLDA1_CYNCA Phospholipase D alpha 1 OS=Cynara cardunculus GN=PLD1 PE=1 SV=2 77 510 2.0E-24
sp|O82549|PLDA1_BRAOC Phospholipase D alpha 1 OS=Brassica oleracea var. capitata GN=PLD1 PE=2 SV=1 77 510 5.0E-24
sp|Q9T053|PLDG1_ARATH Phospholipase D gamma 1 OS=Arabidopsis thaliana GN=PLDGAMMA1 PE=1 SV=1 83 528 7.0E-24
sp|P97813|PLD2_MOUSE Phospholipase D2 OS=Mus musculus GN=Pld2 PE=1 SV=2 631 831 8.0E-24
sp|Q9M9W8|PLDZ2_ARATH Phospholipase D zeta 2 OS=Arabidopsis thaliana GN=PLPZETA2 PE=1 SV=2 634 830 1.0E-23
sp|Q43270|PLDA1_MAIZE Phospholipase D alpha 1 OS=Zea mays GN=PLD1 PE=2 SV=1 77 510 1.0E-23
sp|Q9SSQ9|PLDA2_ARATH Phospholipase D alpha 2 OS=Arabidopsis thaliana GN=PLDALPHA2 PE=2 SV=1 77 510 2.0E-23
sp|P93400|PLDA1_TOBAC Phospholipase D alpha 1 OS=Nicotiana tabacum GN=PLD1 PE=2 SV=2 77 510 2.0E-23
sp|Q9T052|PLDG3_ARATH Phospholipase D gamma 3 OS=Arabidopsis thaliana GN=PLDGAMMA3 PE=1 SV=1 83 510 9.0E-23
sp|P55939|PLDA2_BRAOC Phospholipase D alpha 2 OS=Brassica oleracea var. capitata GN=PLD2 PE=1 SV=2 103 510 1.0E-22
sp|Q38882|PLDA1_ARATH Phospholipase D alpha 1 OS=Arabidopsis thaliana GN=PLDALPHA1 PE=1 SV=2 77 510 1.0E-22
sp|Q13393|PLD1_HUMAN Phospholipase D1 OS=Homo sapiens GN=PLD1 PE=1 SV=1 629 831 2.0E-22
sp|Q41142|PLDA1_RICCO Phospholipase D alpha 1 OS=Ricinus communis GN=PLD1 PE=1 SV=1 77 510 2.0E-22
sp|P86387|PLDA1_CARPA Phospholipase D alpha 1 OS=Carica papaya GN=PLD1 PE=1 SV=1 103 510 8.0E-22
sp|P70496|PLD1_RAT Phospholipase D1 OS=Rattus norvegicus GN=Pld1 PE=1 SV=3 629 831 1.0E-21
sp|Q9T051|PLDG2_ARATH Phospholipase D gamma 2 OS=Arabidopsis thaliana GN=PLDGAMMA2 PE=1 SV=3 83 510 2.0E-21
sp|O08684|PLD1_CRIGR Phospholipase D1 OS=Cricetulus griseus GN=PLD1 PE=2 SV=1 629 831 2.0E-21
sp|Q9Z280|PLD1_MOUSE Phospholipase D1 OS=Mus musculus GN=Pld1 PE=2 SV=1 629 831 2.0E-21
sp|O04865|PLDA1_VIGUN Phospholipase D alpha 1 OS=Vigna unguiculata GN=PLD1 PE=2 SV=1 103 539 2.0E-20
sp|P93733|PLDB1_ARATH Phospholipase D beta 1 OS=Arabidopsis thaliana GN=PLDBETA1 PE=1 SV=4 77 510 2.0E-20
sp|O23078|PLDB2_ARATH Phospholipase D beta 2 OS=Arabidopsis thaliana GN=PLDBETA2 PE=2 SV=3 77 517 3.0E-20
sp|P93844|PLDA2_ORYSJ Phospholipase D alpha 2 OS=Oryza sativa subsp. japonica GN=PLD2 PE=2 SV=2 77 539 5.0E-20
sp|Q9C888|PLDA4_ARATH Phospholipase D alpha 4 OS=Arabidopsis thaliana GN=PLDALPHA4 PE=2 SV=1 92 538 6.0E-20
sp|Q9LRZ5|PLDZ1_ARATH Phospholipase D zeta 1 OS=Arabidopsis thaliana GN=PLDZETA1 PE=1 SV=1 634 826 6.0E-20
sp|Q5BMR2|PLD_PHYIN Phospholipase D OS=Phytophthora infestans GN=PLD PE=3 SV=1 633 783 8.0E-20
sp|Q9C5Y0|PLDD1_ARATH Phospholipase D delta OS=Arabidopsis thaliana GN=PLDDELTA PE=1 SV=2 76 516 2.0E-19
sp|Q09706|PLD1_SCHPO Phospholipase D1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pld1 PE=1 SV=1 631 708 2.0E-19
sp|Q54WR4|PLDB_DICDI Phospholipase D B OS=Dictyostelium discoideum GN=pldB PE=2 SV=1 633 847 2.0E-18
sp|P58766|PLDA3_ARATH Phospholipase D alpha 3 OS=Arabidopsis thaliana GN=PLDALPHA3 PE=2 SV=1 103 573 6.0E-18
sp|Q54WR4|PLDB_DICDI Phospholipase D B OS=Dictyostelium discoideum GN=pldB PE=2 SV=1 361 514 4.0E-17
sp|P36126|SPO14_YEAST Phospholipase D1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO14 PE=1 SV=3 631 707 2.0E-16
sp|Q54Z25|PLDC_DICDI Phospholipase D C OS=Dictyostelium discoideum GN=pldC PE=3 SV=1 625 785 3.0E-16
sp|Q54UK0|PLDA_DICDI Phospholipase D A OS=Dictyostelium discoideum GN=pldA PE=2 SV=1 629 710 1.0E-15
sp|O04883|PLDA1_PIMBR Phospholipase D alpha 1 OS=Pimpinella brachycarpa GN=PLD1 PE=2 SV=1 103 510 9.0E-15
sp|Q54Z25|PLDC_DICDI Phospholipase D C OS=Dictyostelium discoideum GN=pldC PE=3 SV=1 367 514 1.0E-13
sp|P58766|PLDA3_ARATH Phospholipase D alpha 3 OS=Arabidopsis thaliana GN=PLDALPHA3 PE=2 SV=1 635 789 1.0E-07
sp|O82549|PLDA1_BRAOC Phospholipase D alpha 1 OS=Brassica oleracea var. capitata GN=PLD1 PE=2 SV=1 635 804 3.0E-07
sp|P55939|PLDA2_BRAOC Phospholipase D alpha 2 OS=Brassica oleracea var. capitata GN=PLD2 PE=1 SV=2 635 804 6.0E-07
sp|O04883|PLDA1_PIMBR Phospholipase D alpha 1 OS=Pimpinella brachycarpa GN=PLD1 PE=2 SV=1 635 804 7.0E-07
sp|Q38882|PLDA1_ARATH Phospholipase D alpha 1 OS=Arabidopsis thaliana GN=PLDALPHA1 PE=1 SV=2 635 789 1.0E-06
sp|Q9SSQ9|PLDA2_ARATH Phospholipase D alpha 2 OS=Arabidopsis thaliana GN=PLDALPHA2 PE=2 SV=1 613 717 1.0E-06
sp|P86387|PLDA1_CARPA Phospholipase D alpha 1 OS=Carica papaya GN=PLD1 PE=1 SV=1 578 721 3.0E-06
sp|Q41142|PLDA1_RICCO Phospholipase D alpha 1 OS=Ricinus communis GN=PLD1 PE=1 SV=1 635 709 3.0E-06
sp|O04865|PLDA1_VIGUN Phospholipase D alpha 1 OS=Vigna unguiculata GN=PLD1 PE=2 SV=1 635 709 4.0E-06
sp|P93400|PLDA1_TOBAC Phospholipase D alpha 1 OS=Nicotiana tabacum GN=PLD1 PE=2 SV=2 635 709 4.0E-06
sp|Q70EW5|PLDA1_CYNCA Phospholipase D alpha 1 OS=Cynara cardunculus GN=PLD1 PE=1 SV=2 635 709 4.0E-06
sp|Q43270|PLDA1_MAIZE Phospholipase D alpha 1 OS=Zea mays GN=PLD1 PE=2 SV=1 635 789 5.0E-06
sp|Q43007|PLDA1_ORYSJ Phospholipase D alpha 1 OS=Oryza sativa subsp. japonica GN=PLD1 PE=1 SV=2 635 721 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2384
MSDPKDDQGSFSSFVGDLRDKLHDSKLHDAKVHLIHKKHQIGKLGNLFNRDHRHDEEHEQKCDEKRTKTCETNRF
QSFFPERDGNLVKWYVDGRDYFWAVSVALEEAQESIYIADWWLSPELFLRRPPYHEQEYRLDQILKRRAEAGVKI
YIIVYKEVEAALTCNSHHTKTSLQALCPEGSPGYGNIRVVRHPDHNVFENAADMTMYWAHHEKFIVIDYNLAFIG
GLDLCFGRWDARQHPLSDVHPEGISEEVWPGQDFNNNRIMDFKKVEDWQQNELSKAEYGRMPWHDVAMALIGPCV
YDIAEHFVLRWNFIKRDKHKRDERCDWLILEGREGDDEDLVGVQRPKHPVGEYVKHPLTPLASKRLENQGTIHAQ
IVRSSADWSSGILTDHSIQNAYCEVIRKAEHYIYIENQFFITATGDQQSPIHNTIGAAMVDAVVRAAKEGRKFRI
IIIIPAIPGFAGDLRENAASGTRAIMDYQYKSICRGEHSIFERIKAQGVDPSQHIFFFNLRSYDRLNKTHAIAEA
EKKTGISYQQVQRAEAEEIMAEGVYGFEDDSSDDGRQSKGKNKSNAPSGPSDDVIQARKAFEEAKPDEEVVSAAS
VAHHALVGQGSLKDEPWDSHEDPESEMRNWIQEELYVHAKLLIADDRVVICGSSNINDRSQLGDHDSELSIVMED
TRRISSTMDGKPFEAGYHAVTLRRFLWREHMGLLPPQELDAAGDINAQPPTVNAENNIYDDDSYKFVEDPLSDEL
WSMWTGQADKNTGLFRHLFHADPDDNIKTFEDYDRYLPPKGVKSGHIYDQFMPPEDARDKLDQIKGHLVWMPMAF
LEDAEMAERGLQVNAWTESVYT
Coding >Ophio5|2384
ATGTCGGATCCCAAGGACGACCAGGGCAGCTTCTCCTCCTTCGTCGGCGACCTCAGAGACAAGCTTCATGACAGC
AAGCTTCACGACGCCAAGGTCCATCTCATCCACAAAAAGCATCAGATTGGAAAGCTGGGAAACCTGTTCAATAGA
GACCACCGCCACGACGAGGAACACGAGCAGAAGTGTGACGAAAAGAGGACCAAGACGTGCGAAACCAACCGCTTT
CAGTCCTTCTTCCCCGAGCGAGACGGCAATCTCGTTAAGTGGTATGTCGACGGTCGCGACTACTTCTGGGCCGTT
TCGGTGGCCCTAGAAGAAGCTCAGGAGTCCATCTACATCGCAGACTGGTGGCTCTCTCCGGAGCTTTTTCTTCGA
CGTCCGCCATACCACGAGCAGGAATACCGTCTCGACCAGATCCTCAAGCGGAGGGCAGAGGCGGGCGTCAAGATC
TACATCATCGTCTACAAGGAGGTCGAAGCCGCTCTAACCTGTAACTCTCACCATACCAAAACTTCGCTGCAGGCC
CTTTGTCCCGAGGGCTCACCAGGCTACGGAAATATTCGCGTGGTGCGACACCCGGACCATAACGTCTTCGAGAAC
GCCGCAGACATGACCATGTACTGGGCCCATCACGAAAAGTTCATCGTCATCGACTACAATCTGGCCTTCATCGGC
GGGCTCGACCTCTGTTTCGGCCGTTGGGATGCTCGACAGCACCCTCTATCCGACGTCCATCCCGAGGGCATCTCG
GAGGAGGTATGGCCAGGCCAAGACTTCAACAACAACCGCATCATGGACTTCAAAAAGGTCGAGGACTGGCAGCAG
AACGAGCTGAGCAAGGCCGAGTACGGCCGCATGCCGTGGCACGATGTCGCCATGGCCCTTATTGGGCCCTGCGTT
TACGACATTGCCGAGCACTTCGTCCTACGCTGGAACTTTATCAAGCGGGACAAGCACAAGCGTGACGAACGCTGC
GATTGGCTTATCCTCGAAGGTCGCGAGGGTGACGACGAGGATCTGGTGGGCGTTCAGCGCCCCAAGCACCCCGTC
GGAGAATACGTCAAGCACCCCTTGACGCCCCTCGCCTCCAAGAGGCTCGAAAACCAGGGTACGATCCACGCGCAA
ATTGTCCGCTCCAGCGCCGACTGGTCCAGCGGGATCCTCACCGACCATTCCATTCAAAACGCCTACTGTGAGGTC
ATCCGCAAGGCAGAACACTACATTTACATCGAGAACCAGTTCTTCATCACGGCCACGGGCGACCAGCAGTCTCCC
ATCCATAACACCATCGGCGCGGCCATGGTGGACGCCGTTGTCCGGGCAGCCAAGGAGGGTCGCAAGTTCCGCATC
ATCATCATCATCCCGGCGATCCCGGGCTTCGCCGGTGACTTGCGTGAGAATGCGGCTTCGGGCACTCGAGCCATC
ATGGACTATCAGTACAAGTCGATATGCCGCGGAGAGCATTCCATCTTCGAGCGCATCAAGGCCCAAGGCGTCGAC
CCGAGCCAGCACATCTTCTTCTTCAATCTCAGGTCCTACGACCGCCTCAACAAGACTCATGCCATCGCCGAGGCA
GAGAAGAAGACGGGAATTAGCTACCAACAGGTGCAGCGAGCTGAGGCAGAGGAGATCATGGCCGAGGGCGTTTAC
GGATTCGAAGACGACAGCTCCGACGATGGCAGGCAGTCAAAGGGCAAGAACAAATCCAACGCTCCAAGTGGACCA
TCGGATGATGTGATTCAAGCTCGCAAGGCGTTTGAGGAGGCAAAGCCCGACGAAGAGGTGGTGTCGGCTGCATCT
GTTGCCCACCACGCTCTGGTCGGTCAGGGCTCCCTCAAGGACGAGCCGTGGGACAGCCATGAGGACCCGGAGTCT
GAGATGCGGAACTGGATCCAAGAAGAGCTCTATGTCCACGCCAAGCTGCTCATTGCCGACGACCGGGTGGTCATC
TGCGGTTCGAGCAACATCAACGACCGCAGCCAGTTGGGAGACCACGACAGCGAGCTAAGCATCGTCATGGAGGAC
ACCAGAAGAATTTCTAGCACCATGGATGGCAAGCCGTTCGAGGCAGGCTACCACGCCGTCACTCTGCGCCGCTTC
CTGTGGCGCGAGCACATGGGTCTCTTGCCGCCACAGGAGCTTGATGCGGCCGGCGATATCAATGCCCAGCCTCCC
ACGGTGAATGCGGAAAACAACATATACGACGACGATAGCTACAAGTTTGTGGAGGATCCCTTAAGTGACGAGCTC
TGGTCCATGTGGACCGGTCAGGCGGATAAGAACACTGGCCTGTTCCGGCACCTGTTCCACGCGGACCCGGACGAC
AACATTAAAACCTTTGAGGACTACGACCGCTATCTCCCGCCAAAGGGCGTCAAATCGGGTCACATCTATGATCAA
TTCATGCCGCCCGAAGACGCACGGGATAAGCTCGACCAGATTAAGGGACACTTGGTGTGGATGCCGATGGCGTTT
CTAGAAGACGCCGAAATGGCAGAAAGGGGATTGCAGGTCAACGCTTGGACGGAGAGCGTGTACACC
Transcript >Ophio5|2384
ATGTCGGATCCCAAGGACGACCAGGGCAGCTTCTCCTCCTTCGTCGGCGACCTCAGAGACAAGCTTCATGACAGC
AAGCTTCACGACGCCAAGGTCCATCTCATCCACAAAAAGCATCAGATTGGAAAGCTGGGAAACCTGTTCAATAGA
GACCACCGCCACGACGAGGAACACGAGCAGAAGTGTGACGAAAAGAGGACCAAGACGTGCGAAACCAACCGCTTT
CAGTCCTTCTTCCCCGAGCGAGACGGCAATCTCGTTAAGTGGTATGTCGACGGTCGCGACTACTTCTGGGCCGTT
TCGGTGGCCCTAGAAGAAGCTCAGGAGTCCATCTACATCGCAGACTGGTGGCTCTCTCCGGAGCTTTTTCTTCGA
CGTCCGCCATACCACGAGCAGGAATACCGTCTCGACCAGATCCTCAAGCGGAGGGCAGAGGCGGGCGTCAAGATC
TACATCATCGTCTACAAGGAGGTCGAAGCCGCTCTAACCTGTAACTCTCACCATACCAAAACTTCGCTGCAGGCC
CTTTGTCCCGAGGGCTCACCAGGCTACGGAAATATTCGCGTGGTGCGACACCCGGACCATAACGTCTTCGAGAAC
GCCGCAGACATGACCATGTACTGGGCCCATCACGAAAAGTTCATCGTCATCGACTACAATCTGGCCTTCATCGGC
GGGCTCGACCTCTGTTTCGGCCGTTGGGATGCTCGACAGCACCCTCTATCCGACGTCCATCCCGAGGGCATCTCG
GAGGAGGTATGGCCAGGCCAAGACTTCAACAACAACCGCATCATGGACTTCAAAAAGGTCGAGGACTGGCAGCAG
AACGAGCTGAGCAAGGCCGAGTACGGCCGCATGCCGTGGCACGATGTCGCCATGGCCCTTATTGGGCCCTGCGTT
TACGACATTGCCGAGCACTTCGTCCTACGCTGGAACTTTATCAAGCGGGACAAGCACAAGCGTGACGAACGCTGC
GATTGGCTTATCCTCGAAGGTCGCGAGGGTGACGACGAGGATCTGGTGGGCGTTCAGCGCCCCAAGCACCCCGTC
GGAGAATACGTCAAGCACCCCTTGACGCCCCTCGCCTCCAAGAGGCTCGAAAACCAGGGTACGATCCACGCGCAA
ATTGTCCGCTCCAGCGCCGACTGGTCCAGCGGGATCCTCACCGACCATTCCATTCAAAACGCCTACTGTGAGGTC
ATCCGCAAGGCAGAACACTACATTTACATCGAGAACCAGTTCTTCATCACGGCCACGGGCGACCAGCAGTCTCCC
ATCCATAACACCATCGGCGCGGCCATGGTGGACGCCGTTGTCCGGGCAGCCAAGGAGGGTCGCAAGTTCCGCATC
ATCATCATCATCCCGGCGATCCCGGGCTTCGCCGGTGACTTGCGTGAGAATGCGGCTTCGGGCACTCGAGCCATC
ATGGACTATCAGTACAAGTCGATATGCCGCGGAGAGCATTCCATCTTCGAGCGCATCAAGGCCCAAGGCGTCGAC
CCGAGCCAGCACATCTTCTTCTTCAATCTCAGGTCCTACGACCGCCTCAACAAGACTCATGCCATCGCCGAGGCA
GAGAAGAAGACGGGAATTAGCTACCAACAGGTGCAGCGAGCTGAGGCAGAGGAGATCATGGCCGAGGGCGTTTAC
GGATTCGAAGACGACAGCTCCGACGATGGCAGGCAGTCAAAGGGCAAGAACAAATCCAACGCTCCAAGTGGACCA
TCGGATGATGTGATTCAAGCTCGCAAGGCGTTTGAGGAGGCAAAGCCCGACGAAGAGGTGGTGTCGGCTGCATCT
GTTGCCCACCACGCTCTGGTCGGTCAGGGCTCCCTCAAGGACGAGCCGTGGGACAGCCATGAGGACCCGGAGTCT
GAGATGCGGAACTGGATCCAAGAAGAGCTCTATGTCCACGCCAAGCTGCTCATTGCCGACGACCGGGTGGTCATC
TGCGGTTCGAGCAACATCAACGACCGCAGCCAGTTGGGAGACCACGACAGCGAGCTAAGCATCGTCATGGAGGAC
ACCAGAAGAATTTCTAGCACCATGGATGGCAAGCCGTTCGAGGCAGGCTACCACGCCGTCACTCTGCGCCGCTTC
CTGTGGCGCGAGCACATGGGTCTCTTGCCGCCACAGGAGCTTGATGCGGCCGGCGATATCAATGCCCAGCCTCCC
ACGGTGAATGCGGAAAACAACATATACGACGACGATAGCTACAAGTTTGTGGAGGATCCCTTAAGTGACGAGCTC
TGGTCCATGTGGACCGGTCAGGCGGATAAGAACACTGGCCTGTTCCGGCACCTGTTCCACGCGGACCCGGACGAC
AACATTAAAACCTTTGAGGACTACGACCGCTATCTCCCGCCAAAGGGCGTCAAATCGGGTCACATCTATGATCAA
TTCATGCCGCCCGAAGACGCACGGGATAAGCTCGACCAGATTAAGGGACACTTGGTGTGGATGCCGATGGCGTTT
CTAGAAGACGCCGAAATGGCAGAAAGGGGATTGCAGGTCAACGCTTGGACGGAGAGCGTGTACACCTGA
Gene >Ophio5|2384
ATGTCGGATCCCAAGGACGACCAGGGCAGCTTCTCCTCCTTCGTCGGCGACCTCAGAGACAAGCTTCATGACAGC
AAGCTTCACGACGCCAAGGTCCATCTCATCCACAAAAAGTCCGTACTTCTCTGCTTCTCGCCCTGATCCTGGTCC
TGGTCCTGTCCTGGCTCATGTTTCGTTTCCGCTGACGTCGCGCCTCCTTCCAGGCATCAGATTGGAAAGCTGGGA
AACCTGGTGAGTGCCCTCTTCCCTTCCGGTCGTTCTCGTCGTTTCTGCCCCGCGCCTGACGTTTCATGTGCGTTA
TGTACCACGCCGACCTAACCGACGATCATGGCAGTTCAATAGAGACCACCGCCACGACGAGGAACACGAGCAGAA
GTGTGACGAAAAGAGGACCAAGACGTGCGAAACCAACCGCTTTCAGTCCTTCTTCCCCGAGCGAGACGGCAATCT
CGTTAAGTGGTATGTCGACGGTCGCGACTACTTCTGGGCCGTTTCGGTGGCCCTAGAAGAAGCTCAGGAGTCCAT
CTACATCGCAGACTGGTGGCTCTCTCCGGAGCTTTTTCTTCGACGTCCGCCATACCACGAGCAGGAATACCGTCT
CGACCAGATCCTCAAGCGGAGGGCAGAGGCGGGCGTCAAGATCTACATCATCGTCTACAAGGAGGTCGAAGCCGC
TCTAACCTGTAACTCTCACCATACCAAAACTTCGCTGCAGGCCCTTTGTCCCGAGGGCTCACCAGGCTACGGAAA
TATTCGCGTGGTGCGACACCCGGACCATAACGTCTTCGAGAACGCCGCAGACATGACCATGTACTGGGCCCATCA
CGAAAAGTTCATCGTCATCGACTACAATCTGGCCTTCATCGGCGGGCTCGACCTCTGTTTCGGCCGTTGGGATGC
TCGACAGCACCCTCTATCCGACGTCCATCCCGAGGGCATCTCGGAGGAGGTATGGCCAGGCCAAGACTTCAACAA
CAACCGCATCATGGACTTCAAAAAGGTCGAGGACTGGCAGCAGAACGAGCTGAGCAAGGCCGAGTACGGCCGCAT
GCCGTGGCACGATGTCGCCATGGCCCTTATTGGGCCCTGCGTTTACGACATTGCCGAGCACTTCGTCCTACGCTG
GAACTTTATCAAGCGGGACAAGCACAAGCGTGACGAACGCTGCGATTGGCTTATCCTCGAAGGTCGCGAGGGTGA
CGACGAGGATCTGGTGGGCGTTCAGCGCCCCAAGCACCCCGTCGGAGAATACGTCAAGCACCCCTTGACGCCCCT
CGCCTCCAAGAGGCTCGAAAACCAGGGTACGATCCACGCGCAAATTGTCCGCTCCAGCGCCGACTGGTCCAGCGG
GATCCTCACCGACCATTCCATTCAAAACGCCTACTGTGAGGTCATCCGCAAGGCAGAACACTACATTTACATCGA
GAACCAGTTCTTCATCACGGCCACGGGCGACCAGCAGTCTCCCATCCATAACACCATCGGCGCGGCCATGGTGGA
CGCCGTTGTCCGGGCAGCCAAGGAGGGTCGCAAGTTCCGCATCATCATCATCATCCCGGCGATCCCGGGCTTCGC
CGGTGACTTGCGTGAGAATGCGGCTTCGGGCACTCGAGCCATCATGGACTATCAGTACAAGTCGATATGCCGCGG
AGAGCATTCCATCTTCGAGCGCATCAAGGCCCAAGGCGTCGACCCGAGCCAGCACATCTTCTTCTTCAATCTCAG
GTCCTACGACCGCCTCAACAAGACTCATGCCATCGCCGAGGCAGAGAAGAAGACGGGAATTAGCTACCAACAGGT
GCAGCGAGCTGAGGCAGAGGAGATCATGGCCGAGGGCGTTTACGGATTCGAAGACGACAGCTCCGACGATGGCAG
GCAGTCAAAGGGCAAGAACAAATCCAACGCTCCAAGTGGACCATCGGATGATGTGATTCAAGCTCGCAAGGCGTT
TGAGGAGGCAAAGCCCGACGAAGAGGTGGTGTCGGCTGCATCTGTTGCCCACCACGCTCTGGTCGGTCAGGGCTC
CCTCAAGGACGAGCCGTGGGACAGCCATGAGGACCCGGAGTCTGAGATGCGGAACTGGATCCAAGAAGAGCTCTA
TGTCCACGCCAAGCTGCTCATTGCCGACGACCGGGTGGTCATCTGCGGTTCGAGCAACATCAACGACCGCAGCCA
GTTGGGAGACCACGACAGCGAGCTAAGCATCGTCATGGAGGACACCAGAAGAATTTCTAGCACCATGGATGGCAA
GCCGTTCGAGGCAGGCTACCACGCCGTCACTCTGCGCCGCTTCCTGTGGCGCGAGCACATGGGTCTCTTGCCGCC
ACAGGAGCTTGATGCGGCCGGCGATATCAATGCCCAGCCTCCCACGGTGAATGCGGAAAACAACATATACGACGA
CGATAGCTACAAGTTTGTGGAGGATCCCTTAAGTGACGAGCTCTGGTCCATGTGGACCGGTCAGGCGGATAAGAA
CACTGGCCTGTTCCGGCACCTGTTCCACGCGGACCCGGACGACAACAGTAAGTCTACCGTGTCTCGGCAATTCCC
TTCTGTCACGGCACCCGCTGATCATAAACATAGTTAAAACCTTTGAGGACTACGACCGCTATCTCCCGCCAAAGG
GCGTCAAATCGGGTCACATCTATGATCAATTCATGCCGCCCGAAGACGCACGGGATAAGCTCGACCAGATTAAGG
GACACTTGGTGTGGATGCCGATGGCGTTTCTAGAAGACGCCGAAATGGCAGAAAGGGGATTGCAGGTCAACGCTT
GGACGGAGAGCGTGTACACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail