Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2380
Gene name
Locationscaffold_2:126550..128928
Strand+
Gene length (bp)2378
Transcript length (bp)1992
Coding sequence length (bp)1989
Protein length (aa) 663

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 2.0E-21 170 376
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 5.4E-11 13 45

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28349|NIT4_NEUCR Nitrogen assimilation transcription factor nit-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-4 PE=3 SV=2 2 570 2.0E-31
sp|Q9P6I9|YHDD_SCHPO Uncharacterized transcriptional regulatory protein C1683.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.13c PE=1 SV=1 5 588 5.0E-28
sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor nirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nirA PE=3 SV=1 166 533 1.0E-26
sp|O74541|YCV2_SCHPO Uncharacterized transcriptional regulatory protein C777.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.02 PE=3 SV=4 10 571 7.0E-24
sp|O74915|YJ74_SCHPO Uncharacterized transcriptional regulatory protein C757.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.04 PE=3 SV=2 12 531 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28349|NIT4_NEUCR Nitrogen assimilation transcription factor nit-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-4 PE=3 SV=2 2 570 2.0E-31
sp|Q9P6I9|YHDD_SCHPO Uncharacterized transcriptional regulatory protein C1683.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.13c PE=1 SV=1 5 588 5.0E-28
sp|P28348|NIRA_EMENI Nitrogen assimilation transcription factor nirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nirA PE=3 SV=1 166 533 1.0E-26
sp|O74541|YCV2_SCHPO Uncharacterized transcriptional regulatory protein C777.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC777.02 PE=3 SV=4 10 571 7.0E-24
sp|O74915|YJ74_SCHPO Uncharacterized transcriptional regulatory protein C757.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.04 PE=3 SV=2 12 531 5.0E-22
sp|P43634|CHA4_YEAST Activatory protein CHA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHA4 PE=1 SV=1 8 392 2.0E-16
sp|G2TRN9|YAOB_SCHPO Uncharacterized transcriptional regulatory protein C11D3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.11c PE=1 SV=1 11 344 5.0E-16
sp|P47988|TEA1_YEAST TY1 enhancer activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEA1 PE=1 SV=2 168 345 1.0E-13
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 13 502 1.0E-12
sp|O94490|YC79_SCHPO Uncharacterized transcriptional regulatory protein C417.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.09c PE=3 SV=1 14 572 5.0E-08
sp|O59744|YN28_SCHPO Uncharacterized transcriptional regulatory protein C530.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.08 PE=3 SV=1 252 468 2.0E-07
sp|Q1MTM9|YFN1_SCHPO Uncharacterized transcriptional regulatory protein C1327.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1327.01c PE=1 SV=2 5 57 9.0E-07
sp|O60130|YH7G_SCHPO Putative transcriptional regulatory protein C16G5.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.16 PE=1 SV=1 252 520 3.0E-06
sp|P36598|THI1_SCHPO Thiamine repressible genes regulatory protein thi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thi1 PE=1 SV=2 253 520 3.0E-06
sp|P10563|QUTA_EMENI Quinic acid utilization activator OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutA PE=3 SV=2 239 475 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0046872 metal ion binding No
GO:0046483 heterocycle metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0140110 transcription regulator activity No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0046914 transition metal ion binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0050789 regulation of biological process No
GO:0016070 RNA metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009889 regulation of biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2380
MSSVKTKKKSAFSCDPCRRRKVKCGGEQPVCQRCAARNDQCVYKLNPTLSYTQRLEERIKELEDQLAGVVPSPVM
PSSSSMPSPDSLDGPSPGIARSFRGLKVDDKGGITYHGTTSFFNLPSDRFPASDLLAPADVDLRRRERLVNNAWQ
QRALENMSEIPEPFQYLLHVHWCWIQPMFGFIYRPAFTRDMQSLGPYYSHTLLNAVISHSIRWGQSDPSTKRLLD
ESYEGGAVFAQHTRSMVFDELSRGVCTIPTVQTLLLLSAQECSLGNSTQAWTYSGLAFRLMDHLGICVDGRRFPG
SVPLTDEELEIRHRVFWSCYLWDKLISLYLGRSPSLQQSSLSPPQIMFDDSAEDDLWVPFGAQQVGVTWKYPPTT
AHSASCFMSMCRLSVIFNEMLIHMYDPLSQNTDAEVRECLRTQEPALHEWWNQLQAHLRLDPAALPALAPPSHIV
TLNCLYHTFKILLYRPMLTGRGKRDNDGDGTSPAKSHLVECVTSATAIITIFDLFCRTFTMNYCVLSLAYSVYTA
ASVFLLQVQASPGEQQASRRLEYCCQCLSQVKTISPVINSALDLIHNALDAVSPTPSRLAEKTDDAPSPTMAMYQ
NPVDMSRQLPLPSHPLFQPAMNHVAGTESMAMHPGVFETMSNLEPLSVRVGAIPGPENPAPAG
Coding >Ophio5|2380
ATGTCGTCGGTCAAGACGAAGAAGAAGTCGGCCTTTAGCTGCGATCCATGTCGACGGCGCAAGGTCAAGTGCGGC
GGCGAGCAGCCCGTCTGCCAACGCTGTGCCGCGCGCAACGATCAGTGCGTCTACAAGCTCAACCCGACCCTGTCC
TACACGCAACGCCTCGAGGAGCGAATCAAGGAGCTCGAGGACCAGCTCGCCGGCGTGGTCCCGTCTCCCGTCATG
CCCTCGTCTTCGTCCATGCCGAGTCCCGACTCCCTTGATGGCCCCTCACCCGGCATCGCCCGCAGCTTCCGAGGC
CTCAAGGTCGACGACAAGGGTGGCATCACCTACCACGGCACAACCAGCTTCTTCAACCTGCCCAGCGACCGCTTC
CCAGCATCCGATCTGCTGGCCCCGGCCGACGTCGATCTGCGTCGTCGCGAGCGGCTCGTCAACAATGCCTGGCAG
CAGCGCGCTCTCGAGAACATGTCCGAGATTCCGGAGCCCTTCCAGTATCTCCTCCACGTCCATTGGTGCTGGATC
CAACCCATGTTCGGCTTCATCTACCGTCCGGCCTTTACGCGTGACATGCAGTCGCTCGGGCCCTACTACTCGCAC
ACACTTCTCAACGCCGTCATCTCGCACTCGATTCGCTGGGGCCAAAGCGACCCTTCGACCAAGCGGCTGCTGGAC
GAGTCGTACGAAGGCGGCGCCGTCTTCGCCCAACACACGCGCAGCATGGTCTTTGACGAGCTGAGCCGTGGCGTC
TGCACCATCCCGACGGTTCAGACGCTCCTCCTGCTGAGCGCGCAGGAATGCAGCCTCGGCAACTCGACGCAGGCC
TGGACCTACAGCGGCCTGGCCTTTCGCCTCATGGACCACCTGGGCATCTGCGTCGACGGCCGCCGCTTCCCGGGC
TCGGTGCCGCTGACGGACGAGGAGCTCGAGATCCGACACCGCGTCTTCTGGAGCTGCTACCTTTGGGACAAGCTC
ATCAGCCTCTATCTCGGCCGCTCGCCTTCGCTGCAGCAGTCGAGCCTGTCGCCGCCGCAGATTATGTTCGACGAC
TCGGCCGAGGACGACCTCTGGGTGCCCTTTGGCGCCCAGCAGGTCGGCGTCACCTGGAAGTACCCGCCGACGACG
GCCCATTCAGCCTCGTGCTTCATGAGCATGTGTCGCCTGTCCGTCATCTTCAACGAGATGCTGATCCACATGTAC
GATCCGCTGTCGCAGAACACCGACGCCGAGGTGCGCGAGTGTCTTCGGACCCAGGAGCCGGCCCTGCACGAGTGG
TGGAACCAACTTCAGGCCCACCTCCGGCTCGATCCGGCCGCGTTGCCGGCCCTGGCCCCGCCGTCTCATATCGTG
ACGCTAAACTGTCTCTATCACACCTTCAAGATCCTCCTCTACCGTCCCATGCTCACCGGTCGTGGCAAGCGTGAC
AACGACGGCGACGGAACCTCGCCGGCCAAGAGCCACCTGGTCGAGTGCGTAACGTCGGCCACGGCCATCATCACC
ATCTTCGACCTCTTCTGCAGGACCTTTACCATGAACTACTGCGTGCTGTCGCTCGCCTACAGCGTCTACACGGCT
GCCTCGGTCTTTTTGCTCCAGGTGCAGGCGAGCCCCGGGGAGCAGCAGGCGTCGCGCAGGCTCGAGTACTGCTGC
CAGTGCCTATCGCAGGTCAAGACCATCAGTCCAGTCATCAATAGTGCCCTGGATCTGATCCATAACGCCCTCGAT
GCCGTCTCGCCTACTCCTTCGCGGCTAGCTGAAAAGACGGACGATGCACCGTCGCCGACCATGGCCATGTATCAG
AACCCGGTCGACATGTCTCGACAGTTGCCGTTGCCCTCTCACCCGCTCTTCCAACCGGCGATGAACCACGTGGCG
GGCACCGAGTCGATGGCGATGCATCCTGGCGTCTTTGAGACCATGTCGAACTTGGAGCCGCTGAGCGTGAGGGTG
GGTGCGATCCCGGGGCCGGAAAACCCAGCGCCGGCAGGT
Transcript >Ophio5|2380
ATGTCGTCGGTCAAGACGAAGAAGAAGTCGGCCTTTAGCTGCGATCCATGTCGACGGCGCAAGGTCAAGTGCGGC
GGCGAGCAGCCCGTCTGCCAACGCTGTGCCGCGCGCAACGATCAGTGCGTCTACAAGCTCAACCCGACCCTGTCC
TACACGCAACGCCTCGAGGAGCGAATCAAGGAGCTCGAGGACCAGCTCGCCGGCGTGGTCCCGTCTCCCGTCATG
CCCTCGTCTTCGTCCATGCCGAGTCCCGACTCCCTTGATGGCCCCTCACCCGGCATCGCCCGCAGCTTCCGAGGC
CTCAAGGTCGACGACAAGGGTGGCATCACCTACCACGGCACAACCAGCTTCTTCAACCTGCCCAGCGACCGCTTC
CCAGCATCCGATCTGCTGGCCCCGGCCGACGTCGATCTGCGTCGTCGCGAGCGGCTCGTCAACAATGCCTGGCAG
CAGCGCGCTCTCGAGAACATGTCCGAGATTCCGGAGCCCTTCCAGTATCTCCTCCACGTCCATTGGTGCTGGATC
CAACCCATGTTCGGCTTCATCTACCGTCCGGCCTTTACGCGTGACATGCAGTCGCTCGGGCCCTACTACTCGCAC
ACACTTCTCAACGCCGTCATCTCGCACTCGATTCGCTGGGGCCAAAGCGACCCTTCGACCAAGCGGCTGCTGGAC
GAGTCGTACGAAGGCGGCGCCGTCTTCGCCCAACACACGCGCAGCATGGTCTTTGACGAGCTGAGCCGTGGCGTC
TGCACCATCCCGACGGTTCAGACGCTCCTCCTGCTGAGCGCGCAGGAATGCAGCCTCGGCAACTCGACGCAGGCC
TGGACCTACAGCGGCCTGGCCTTTCGCCTCATGGACCACCTGGGCATCTGCGTCGACGGCCGCCGCTTCCCGGGC
TCGGTGCCGCTGACGGACGAGGAGCTCGAGATCCGACACCGCGTCTTCTGGAGCTGCTACCTTTGGGACAAGCTC
ATCAGCCTCTATCTCGGCCGCTCGCCTTCGCTGCAGCAGTCGAGCCTGTCGCCGCCGCAGATTATGTTCGACGAC
TCGGCCGAGGACGACCTCTGGGTGCCCTTTGGCGCCCAGCAGGTCGGCGTCACCTGGAAGTACCCGCCGACGACG
GCCCATTCAGCCTCGTGCTTCATGAGCATGTGTCGCCTGTCCGTCATCTTCAACGAGATGCTGATCCACATGTAC
GATCCGCTGTCGCAGAACACCGACGCCGAGGTGCGCGAGTGTCTTCGGACCCAGGAGCCGGCCCTGCACGAGTGG
TGGAACCAACTTCAGGCCCACCTCCGGCTCGATCCGGCCGCGTTGCCGGCCCTGGCCCCGCCGTCTCATATCGTG
ACGCTAAACTGTCTCTATCACACCTTCAAGATCCTCCTCTACCGTCCCATGCTCACCGGTCGTGGCAAGCGTGAC
AACGACGGCGACGGAACCTCGCCGGCCAAGAGCCACCTGGTCGAGTGCGTAACGTCGGCCACGGCCATCATCACC
ATCTTCGACCTCTTCTGCAGGACCTTTACCATGAACTACTGCGTGCTGTCGCTCGCCTACAGCGTCTACACGGCT
GCCTCGGTCTTTTTGCTCCAGGTGCAGGCGAGCCCCGGGGAGCAGCAGGCGTCGCGCAGGCTCGAGTACTGCTGC
CAGTGCCTATCGCAGGTCAAGACCATCAGTCCAGTCATCAATAGTGCCCTGGATCTGATCCATAACGCCCTCGAT
GCCGTCTCGCCTACTCCTTCGCGGCTAGCTGAAAAGACGGACGATGCACCGTCGCCGACCATGGCCATGTATCAG
AACCCGGTCGACATGTCTCGACAGTTGCCGTTGCCCTCTCACCCGCTCTTCCAACCGGCGATGAACCACGTGGCG
GGCACCGAGTCGATGGCGATGCATCCTGGCGTCTTTGAGACCATGTCGAACTTGGAGCCGCTGAGCGTGAGGGTG
GGTGCGATCCCGGGGCCGGAAAACCCAGCGCCGGCAGGTTGA
Gene >Ophio5|2380
ATGTCGTCGGTCAAGACGAAGAAGAAGTCGGCCTTTAGCTGCGATCCATGTCGACGGCGCAAGGTCAGTCAGTCA
GTCCGTTTGGTCGCGACCGTCGTCATCGGTACGCTCACGCCTACTACCAGGTCAAGTGCGGCGGCGAGCAGCCCG
TCTGCCAACGCTGTGCCGCGCGCAACGATCAGTGCGTCTACAAGCTGTGAGCCGCCAGTCGATCCATATCCGCTG
TCGCATGCTTCTTGACAGCTTCTGCAGCAACCCGACCCTGTCCTACACGCAACGCCTCGAGGAGCGAATCAAGGA
GCTCGAGGACCAGCTCGCCGGCGTGGTCCCGTCTCCCGTCATGCCCTCGTCTTCGTCCATGCCGAGTCCCGACTC
CCTTGATGGCCCCTCACCCGGCATCGCCCGCAGCTTCCGAGGCCTCAAGGTCGACGACAAGGGTGGCATCACCTA
CCACGGCACAACCAGCTTCTTCAACCTGCCCAGCGACCGCTTCCCAGCATCCGATCTGCTGGCCCCGGCCGACGT
CGATCTGCGTCGTCGCGAGCGGCTCGTCAACAATGCCTGGCAGCAGCGCGCTCTCGAGAACATGTCCGAGATTCC
GGTAAGTCCAAATCATTCGGCCCTTATGCATGAGCCTGACGACATGCAGGAGCCCTTCCAGTATCTCCTCCACGT
CCATTGGTGCTGGATCCAACCCATGTTCGGCTTCATCTACCGTCCGGCCTTTACGCGTGCGACCGCCCCCTCTCT
CCTCATTCCCCCTCTCGAAACTGATGAGCTCGCGCCGCAGGTGACATGCAGTCGCTCGGGCCCTACTACTCGCAC
ACACTTCTCAACGCCGTCATCTCGCACTCGATTCGCTGGGGCCAAAGCGACCCTTCGACCAAGCGGCTGCTGGAC
GAGTCGTACGAAGGCGGCGCCGTCTTCGCCCAACACACGCGCAGCATGGTCTTTGACGAGCTGAGCCGTGGCGTC
TGCACCATCCCGACGGTTCAGACGCTCCTCCTGCTGAGCGCGCAGGAATGCAGCCTCGGCAACTCGACGCAGGCC
TGGACCTACAGCGGCCTGGCCTTTCGCCTCATGGACCACCTGGGCATCTGCGTCGACGGCCGCCGCTTCCCGGGC
TCGGTGCCGCTGACGGACGAGGAGCTCGAGATCCGACACCGCGTCTTCTGGAGCTGCTACCTTTGGGACAAGCTC
ATCAGCCTCTATCTCGGCCGCTCGCCTTCGCTGCAGCAGTCGAGCCTGTCGCCGCCGCAGATTATGTGTAAGGCC
GCCGCGCCGTTGCCGTCCGCGGGTGACTGAGAAGAAATATCGCGCGCAGTCGACGACTCGGCCGAGGACGACCTC
TGGGTGCCCTTTGGCGCCCAGCAGGTCGGCGTCACCTGGAAGTACCCGCCGACGACGGCCCATTCAGCCTCGTGC
TTCATGAGCATGTGTCGCCTGTCCGTCATCTTCAACGAGATGCTGATCCACATGTACGATCCGCTGTCGCAGAAC
ACCGACGCCGAGGTGCGCGAGTGTCTTCGGACCCAGGAGCCGGCCCTGCACGAGTGGTGGAACCAACTTCAGGCC
CACCTCCGGCTCGATCCGGCCGCGTTGCCGGCCCTGGCCCCGCCGTCTCATATCGTGACGCTAAAGTCGGTTGAA
TCGAGGCCCCTGATTTGGCTGGTCGCTGACGAATGAGAGCTGCGGTCAGCTGTCTCTATCACACCTTCAAGATCC
TCCTCTACCGTCCCATGCTCACCGGTCGTGGCAAGCGTGACAACGACGGCGACGGAACCTCGCCGGCCAAGAGCC
ACCTGGTCGAGTGCGTAACGTCGGCCACGGCCATCATCACCATCTTCGACCTCTTCTGCAGGACCTTTACCATGA
ACTACTGCGTGCTGTCGCTCGCCTACAGCGTCTACACGGCTGCCTCGGTCTTTTTGCTCCAGGTGCAGGCGAGCC
CCGGGGAGCAGCAGGCGTCGCGCAGGCTCGAGTACTGCTGCCAGTGCCTATCGCAGGTCAAGACCATCAGTCCAG
GTAACGGAAGCGCTCTCCTGTCATGTGCCGGCTGATTTTGTCCAGTCATCAATAGTGCCCTGGATCTGATCCATA
ACGCCCTCGATGCCGTCTCGCCTACTCCTTCGCGGCTAGCTGAAAAGACGGACGATGCACCGTCGCCGACCATGG
CCATGTATCAGAACCCGGTCGACATGTCTCGACAGTTGCCGTTGCCCTCTCACCCGCTCTTCCAACCGGCGATGA
ACCACGTGGCGGGCACCGAGTCGATGGCGATGCATCCTGGCGTCTTTGAGACCATGTCGAACTTGGAGCCGCTGA
GCGTGAGGGTGGGTGCGATCCCGGGGCCGGAAAACCCAGCGCCGGCAGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail