Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2376
Gene name
Locationscaffold_2:117352..118945
Strand-
Gene length (bp)1593
Transcript length (bp)1518
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 4.4E-23 61 190
PF08031 BBE Berberine and berberine like 1.4E-09 455 500

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 61 500 7.0E-19
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 62 500 6.0E-18
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 39 494 6.0E-18
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 63 500 4.0E-15
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 27 500 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 61 500 7.0E-19
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 62 500 6.0E-18
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 39 494 6.0E-18
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 63 500 4.0E-15
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 27 500 1.0E-14
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 61 500 2.0E-14
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 49 500 2.0E-13
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 61 500 4.0E-13
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 63 500 6.0E-13
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 61 500 8.0E-13
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 61 500 1.0E-12
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 61 500 2.0E-12
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 63 233 3.0E-12
sp|Q9SVG4|RETOL_ARATH Reticuline oxidase-like protein OS=Arabidopsis thaliana GN=At4g20830 PE=1 SV=2 53 500 8.0E-12
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 41 494 1.0E-11
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 61 259 8.0E-10
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 39 496 5.0E-09
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 45 267 1.0E-08
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 48 231 2.0E-07
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 40 233 3.0E-07
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 61 247 3.0E-07
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 58 222 4.0E-07
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 44 231 6.0E-07
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 45 236 2.0E-06
sp|A0R607|DPRE1_MYCS2 FAD-dependent decaprenylphosphoryl-beta-D-ribofuranose 2-oxidase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dprE1 PE=1 SV=2 60 246 2.0E-06
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 42 238 3.0E-06
sp|Q8LNV6|CKX3_ORYSJ Cytokinin dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CKX3 PE=2 SV=1 51 236 3.0E-06
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 42 237 4.0E-06
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 48 281 4.0E-06
sp|Q5Z620|CKX10_ORYSJ Cytokinin dehydrogenase 10 OS=Oryza sativa subsp. japonica GN=CKX10 PE=3 SV=1 41 237 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.05 0.00 0.24
CcL In ants, during behavior modification 1.86 0.21 3.51
CcD In ants, recently dead 1.16 0.03 2.30

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.318350 no
SC16a CcD 1.000000 no
CcL CcD 0.341894 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2376
MLLSLSRGGILGVLLVGRVLATDKACLQECLQSTGVPSFFKDQAEFANLSSPYNVRLPFTPAAVVTAASADHVSE
AVKCAVQARSGGNSYASHSLGGQNGSLIIDLASMNQVKVNEDMSAEVGGGVRLGNLDRALFDQGKRAMSHGTCAN
VGFGGHSLHGGYGYDSRLWGLSLDHIQSVQVVLANGTISDASPTQNEDLFWAVRGAGESMGVVTKFKIRTQPAPE
SLVYWIFNFSDIVKDIPTTVAALEHIQNFALNKTVQDRRSSWGWYLGRQRFKLRGKFHGPLDEFNQRIAPEILRG
FPNLAEDSRYVRQVNWLQSQALYHHGSDDISQLSQPHEPGEYSTQENFYAKSLTVAGPLTKDAITAYVTFAATEG
AKVKESSIWYSIGNLYGGPDSQIDIYDSSWSSYGNRQSMWVFQNHGTVDLEEPFDTSLPDYLQGLNDATTRYVPP
TQFGAYANYIDPGLSARDAHNLYYGDLYPRLLRIKKSIDPNKTFSNPLAIGVGDF
Coding >Ophio5|2376
ATGCTCCTCAGTTTGTCTCGGGGTGGTATTCTGGGAGTCTTGCTGGTTGGGCGGGTTCTAGCCACAGACAAAGCC
TGCCTCCAAGAGTGCCTGCAATCGACTGGAGTCCCTTCCTTCTTCAAAGACCAAGCCGAGTTTGCAAATTTGTCT
AGCCCCTACAATGTCCGCTTGCCATTCACCCCGGCGGCCGTGGTCACAGCCGCGAGCGCTGATCACGTCTCCGAG
GCTGTCAAATGTGCAGTGCAAGCTAGAAGTGGTGGCAACTCGTATGCATCTCACAGCTTGGGTGGCCAAAATGGT
AGTCTCATCATCGATTTGGCTTCCATGAACCAGGTCAAGGTCAACGAAGACATGTCTGCCGAGGTTGGTGGCGGC
GTGCGTTTAGGAAACCTTGACAGGGCCCTCTTCGACCAGGGAAAGCGTGCCATGAGCCACGGTACTTGCGCCAAC
GTTGGCTTTGGCGGTCATAGTCTGCATGGCGGCTACGGCTACGATTCCCGACTGTGGGGGTTGTCCCTGGATCAT
ATACAATCGGTCCAAGTAGTCCTTGCTAACGGCACGATCTCAGACGCTTCACCCACCCAGAACGAAGACTTATTC
TGGGCAGTCCGAGGAGCTGGCGAGTCCATGGGAGTCGTCACCAAGTTTAAAATACGCACGCAGCCCGCACCGGAA
TCCCTCGTCTACTGGATATTCAATTTCAGTGACATAGTCAAGGATATCCCAACCACGGTTGCGGCGCTCGAGCAC
ATCCAGAACTTTGCTCTAAACAAAACCGTGCAAGATCGGCGTTCGTCCTGGGGGTGGTATCTGGGTCGGCAAAGG
TTCAAGCTTCGGGGGAAGTTCCATGGGCCACTCGACGAATTCAACCAACGAATCGCCCCCGAAATCTTACGCGGC
TTCCCAAATCTTGCCGAGGACTCTCGGTATGTACGCCAAGTCAATTGGCTTCAAAGCCAAGCACTCTACCATCAT
GGTTCCGACGATATCTCGCAGCTCTCTCAACCACATGAGCCCGGGGAGTACTCAACTCAGGAGAACTTCTACGCA
AAGTCCCTTACTGTTGCAGGTCCCTTGACGAAGGATGCTATAACCGCCTACGTTACCTTTGCCGCTACGGAAGGG
GCAAAGGTAAAGGAATCTTCCATCTGGTACAGCATTGGCAACCTCTACGGTGGCCCAGATAGCCAGATCGACATT
TACGACAGCTCGTGGTCGTCTTATGGGAATCGGCAGTCAATGTGGGTGTTTCAGAATCATGGTACCGTCGACTTA
GAGGAACCCTTCGACACTTCCCTGCCCGATTATCTCCAAGGCCTAAACGATGCTACGACGAGATACGTGCCGCCC
ACCCAGTTTGGGGCGTATGCGAACTATATCGATCCAGGTTTAAGTGCCAGGGATGCTCACAATCTCTACTACGGC
GATCTCTATCCCCGGCTGCTTAGGATAAAGAAAAGTATTGATCCTAACAAAACCTTTTCTAATCCTCTCGCTATT
GGAGTCGGTGACTTT
Transcript >Ophio5|2376
ATGCTCCTCAGTTTGTCTCGGGGTGGTATTCTGGGAGTCTTGCTGGTTGGGCGGGTTCTAGCCACAGACAAAGCC
TGCCTCCAAGAGTGCCTGCAATCGACTGGAGTCCCTTCCTTCTTCAAAGACCAAGCCGAGTTTGCAAATTTGTCT
AGCCCCTACAATGTCCGCTTGCCATTCACCCCGGCGGCCGTGGTCACAGCCGCGAGCGCTGATCACGTCTCCGAG
GCTGTCAAATGTGCAGTGCAAGCTAGAAGTGGTGGCAACTCGTATGCATCTCACAGCTTGGGTGGCCAAAATGGT
AGTCTCATCATCGATTTGGCTTCCATGAACCAGGTCAAGGTCAACGAAGACATGTCTGCCGAGGTTGGTGGCGGC
GTGCGTTTAGGAAACCTTGACAGGGCCCTCTTCGACCAGGGAAAGCGTGCCATGAGCCACGGTACTTGCGCCAAC
GTTGGCTTTGGCGGTCATAGTCTGCATGGCGGCTACGGCTACGATTCCCGACTGTGGGGGTTGTCCCTGGATCAT
ATACAATCGGTCCAAGTAGTCCTTGCTAACGGCACGATCTCAGACGCTTCACCCACCCAGAACGAAGACTTATTC
TGGGCAGTCCGAGGAGCTGGCGAGTCCATGGGAGTCGTCACCAAGTTTAAAATACGCACGCAGCCCGCACCGGAA
TCCCTCGTCTACTGGATATTCAATTTCAGTGACATAGTCAAGGATATCCCAACCACGGTTGCGGCGCTCGAGCAC
ATCCAGAACTTTGCTCTAAACAAAACCGTGCAAGATCGGCGTTCGTCCTGGGGGTGGTATCTGGGTCGGCAAAGG
TTCAAGCTTCGGGGGAAGTTCCATGGGCCACTCGACGAATTCAACCAACGAATCGCCCCCGAAATCTTACGCGGC
TTCCCAAATCTTGCCGAGGACTCTCGGTATGTACGCCAAGTCAATTGGCTTCAAAGCCAAGCACTCTACCATCAT
GGTTCCGACGATATCTCGCAGCTCTCTCAACCACATGAGCCCGGGGAGTACTCAACTCAGGAGAACTTCTACGCA
AAGTCCCTTACTGTTGCAGGTCCCTTGACGAAGGATGCTATAACCGCCTACGTTACCTTTGCCGCTACGGAAGGG
GCAAAGGTAAAGGAATCTTCCATCTGGTACAGCATTGGCAACCTCTACGGTGGCCCAGATAGCCAGATCGACATT
TACGACAGCTCGTGGTCGTCTTATGGGAATCGGCAGTCAATGTGGGTGTTTCAGAATCATGGTACCGTCGACTTA
GAGGAACCCTTCGACACTTCCCTGCCCGATTATCTCCAAGGCCTAAACGATGCTACGACGAGATACGTGCCGCCC
ACCCAGTTTGGGGCGTATGCGAACTATATCGATCCAGGTTTAAGTGCCAGGGATGCTCACAATCTCTACTACGGC
GATCTCTATCCCCGGCTGCTTAGGATAAAGAAAAGTATTGATCCTAACAAAACCTTTTCTAATCCTCTCGCTATT
GGAGTCGGTGACTTTTAG
Gene >Ophio5|2376
ATGCTCCTCAGTTTGTCTCGGGGTGGTATTCTGGGAGTCTTGCTGGTTGGGCGGGTTCTAGCCACAGACAAAGCC
TGCCTCCAAGAGTGCCTGCAATCGACTGGAGTCCCTTCCTTCTTCAAAGACCAAGCCGAGTTTGCAAATTTGTCT
AGCCCCTACAATGTCCGCTTGCCATTCACCCCGGCGGCCGTGGTCACAGCCGCGAGCGCTGATCACGTCTCCGAG
GCTGTCAAATGTGCAGTAAGATGCGGGGGCTTCAAGGTGTATACTGCTTCTCTTCCTTTGACCTGAGCGGTTCTC
GACTAATAGTTGTAGGTGCAAGCTAGAAGTGGTGGCAACTCGTATGCATCTCACAGCTTGGGTGGCCAAAATGGT
AGTCTCATCATCGATTTGGCTTCCATGAACCAGGTCAAGGTCAACGAAGACATGTCTGCCGAGGTTGGTGGCGGC
GTGCGTTTAGGAAACCTTGACAGGGCCCTCTTCGACCAGGGAAAGCGTGCCATGAGCCACGGTACTTGCGCCAAC
GTTGGCTTTGGCGGTCATAGTCTGCATGGCGGCTACGGCTACGATTCCCGACTGTGGGGGTTGTCCCTGGATCAT
ATACAATCGGTCCAAGTAGTCCTTGCTAACGGCACGATCTCAGACGCTTCACCCACCCAGAACGAAGACTTATTC
TGGGCAGTCCGAGGAGCTGGCGAGTCCATGGGAGTCGTCACCAAGTTTAAAATACGCACGCAGCCCGCACCGGAA
TCCCTCGTCTACTGGATATTCAATTTCAGTGACATAGTCAAGGATATCCCAACCACGGTTGCGGCGCTCGAGCAC
ATCCAGAACTTTGCTCTAAACAAAACCGTGCAAGATCGGCGTTCGTCCTGGGGGTGGTATCTGGGTCGGCAAAGG
TTCAAGCTTCGGGGGAAGTTCCATGGGCCACTCGACGAATTCAACCAACGAATCGCCCCCGAAATCTTACGCGGC
TTCCCAAATCTTGCCGAGGACTCTCGGTATGTACGCCAAGTCAATTGGCTTCAAAGCCAAGCACTCTACCATCAT
GGTTCCGACGATATCTCGCAGCTCTCTCAACCACATGAGCCCGGGGAGTACTCAACTCAGGAGAACTTCTACGCA
AAGTCCCTTACTGTTGCAGGTCCCTTGACGAAGGATGCTATAACCGCCTACGTTACCTTTGCCGCTACGGAAGGG
GCAAAGGTAAAGGAATCTTCCATCTGGTACAGCATTGGCAACCTCTACGGTGGCCCAGATAGCCAGATCGACATT
TACGACAGCTCGTGGTCGTCTTATGGGAATCGGCAGTCAATGTGGGTGTTTCAGAATCATGGTACCGTCGACTTA
GAGGAACCCTTCGACACTTCCCTGCCCGATTATCTCCAAGGCCTAAACGATGCTACGACGAGATACGTGCCGCCC
ACCCAGTTTGGGGCGTATGCGAACTATATCGATCCAGGTTTAAGTGCCAGGGATGCTCACAATCTCTACTACGGC
GATCTCTATCCCCGGCTGCTTAGGATAAAGAAAAGTATTGATCCTAACAAAACCTTTTCTAATCCTCTCGCTATT
GGAGTCGGTGACTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail