Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2376
Gene name
Locationscaffold_2:117352..118945
Strand-
Gene length (bp)1593
Transcript length (bp)1518
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 4.4E-23 61 190
PF08031 BBE Berberine and berberine like 1.4E-09 455 500

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 61 500 7.0E-19
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 62 500 6.0E-18
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 39 494 6.0E-18
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 63 500 4.0E-15
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 27 500 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 61 500 7.0E-19
sp|Q9FZC6|FOX3_ARATH Flavin-dependent oxidoreductase FOX3 OS=Arabidopsis thaliana GN=FOX3 PE=3 SV=1 62 500 6.0E-18
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 39 494 6.0E-18
sp|Q9FZC8|FOX5_ARATH Flavin-dependent oxidoreductase FOX5 OS=Arabidopsis thaliana GN=FOX5 PE=3 SV=1 63 500 4.0E-15
sp|P93479|RETO_PAPSO Reticuline oxidase OS=Papaver somniferum GN=BBE1 PE=2 SV=1 27 500 1.0E-14
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 61 500 2.0E-14
sp|Q9FZC4|FOX1_ARATH Flavin-dependent oxidoreductase FOX1 OS=Arabidopsis thaliana GN=FOX1 PE=2 SV=1 49 500 2.0E-13
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 61 500 4.0E-13
sp|Q9FZC5|FOX2_ARATH Flavin-dependent oxidoreductase FOX2 OS=Arabidopsis thaliana GN=FOX2 PE=2 SV=1 63 500 6.0E-13
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 61 500 8.0E-13
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 61 500 1.0E-12
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 61 500 2.0E-12
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 63 233 3.0E-12
sp|Q9SVG4|RETOL_ARATH Reticuline oxidase-like protein OS=Arabidopsis thaliana GN=At4g20830 PE=1 SV=2 53 500 8.0E-12
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 41 494 1.0E-11
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 61 259 8.0E-10
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 39 496 5.0E-09
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 45 267 1.0E-08
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 48 231 2.0E-07
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 40 233 3.0E-07
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 61 247 3.0E-07
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 58 222 4.0E-07
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 44 231 6.0E-07
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 45 236 2.0E-06
sp|A0R607|DPRE1_MYCS2 FAD-dependent decaprenylphosphoryl-beta-D-ribofuranose 2-oxidase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=dprE1 PE=1 SV=2 60 246 2.0E-06
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 42 238 3.0E-06
sp|Q8LNV6|CKX3_ORYSJ Cytokinin dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CKX3 PE=2 SV=1 51 236 3.0E-06
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 42 237 4.0E-06
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 48 281 4.0E-06
sp|Q5Z620|CKX10_ORYSJ Cytokinin dehydrogenase 10 OS=Oryza sativa subsp. japonica GN=CKX10 PE=3 SV=1 41 237 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2376
MLLSLSRGGILGVLLVGRVLATDKACLQECLQSTGVPSFFKDQAEFANLSSPYNVRLPFTPAAVVTAASADHVSE
AVKCAVQARSGGNSYASHSLGGQNGSLIIDLASMNQVKVNEDMSAEVGGGVRLGNLDRALFDQGKRAMSHGTCAN
VGFGGHSLHGGYGYDSRLWGLSLDHIQSVQVVLANGTISDASPTQNEDLFWAVRGAGESMGVVTKFKIRTQPAPE
SLVYWIFNFSDIVKDIPTTVAALEHIQNFALNKTVQDRRSSWGWYLGRQRFKLRGKFHGPLDEFNQRIAPEILRG
FPNLAEDSRYVRQVNWLQSQALYHHGSDDISQLSQPHEPGEYSTQENFYAKSLTVAGPLTKDAITAYVTFAATEG
AKVKESSIWYSIGNLYGGPDSQIDIYDSSWSSYGNRQSMWVFQNHGTVDLEEPFDTSLPDYLQGLNDATTRYVPP
TQFGAYANYIDPGLSARDAHNLYYGDLYPRLLRIKKSIDPNKTFSNPLAIGVGDF
Coding >Ophio5|2376
ATGCTCCTCAGTTTGTCTCGGGGTGGTATTCTGGGAGTCTTGCTGGTTGGGCGGGTTCTAGCCACAGACAAAGCC
TGCCTCCAAGAGTGCCTGCAATCGACTGGAGTCCCTTCCTTCTTCAAAGACCAAGCCGAGTTTGCAAATTTGTCT
AGCCCCTACAATGTCCGCTTGCCATTCACCCCGGCGGCCGTGGTCACAGCCGCGAGCGCTGATCACGTCTCCGAG
GCTGTCAAATGTGCAGTGCAAGCTAGAAGTGGTGGCAACTCGTATGCATCTCACAGCTTGGGTGGCCAAAATGGT
AGTCTCATCATCGATTTGGCTTCCATGAACCAGGTCAAGGTCAACGAAGACATGTCTGCCGAGGTTGGTGGCGGC
GTGCGTTTAGGAAACCTTGACAGGGCCCTCTTCGACCAGGGAAAGCGTGCCATGAGCCACGGTACTTGCGCCAAC
GTTGGCTTTGGCGGTCATAGTCTGCATGGCGGCTACGGCTACGATTCCCGACTGTGGGGGTTGTCCCTGGATCAT
ATACAATCGGTCCAAGTAGTCCTTGCTAACGGCACGATCTCAGACGCTTCACCCACCCAGAACGAAGACTTATTC
TGGGCAGTCCGAGGAGCTGGCGAGTCCATGGGAGTCGTCACCAAGTTTAAAATACGCACGCAGCCCGCACCGGAA
TCCCTCGTCTACTGGATATTCAATTTCAGTGACATAGTCAAGGATATCCCAACCACGGTTGCGGCGCTCGAGCAC
ATCCAGAACTTTGCTCTAAACAAAACCGTGCAAGATCGGCGTTCGTCCTGGGGGTGGTATCTGGGTCGGCAAAGG
TTCAAGCTTCGGGGGAAGTTCCATGGGCCACTCGACGAATTCAACCAACGAATCGCCCCCGAAATCTTACGCGGC
TTCCCAAATCTTGCCGAGGACTCTCGGTATGTACGCCAAGTCAATTGGCTTCAAAGCCAAGCACTCTACCATCAT
GGTTCCGACGATATCTCGCAGCTCTCTCAACCACATGAGCCCGGGGAGTACTCAACTCAGGAGAACTTCTACGCA
AAGTCCCTTACTGTTGCAGGTCCCTTGACGAAGGATGCTATAACCGCCTACGTTACCTTTGCCGCTACGGAAGGG
GCAAAGGTAAAGGAATCTTCCATCTGGTACAGCATTGGCAACCTCTACGGTGGCCCAGATAGCCAGATCGACATT
TACGACAGCTCGTGGTCGTCTTATGGGAATCGGCAGTCAATGTGGGTGTTTCAGAATCATGGTACCGTCGACTTA
GAGGAACCCTTCGACACTTCCCTGCCCGATTATCTCCAAGGCCTAAACGATGCTACGACGAGATACGTGCCGCCC
ACCCAGTTTGGGGCGTATGCGAACTATATCGATCCAGGTTTAAGTGCCAGGGATGCTCACAATCTCTACTACGGC
GATCTCTATCCCCGGCTGCTTAGGATAAAGAAAAGTATTGATCCTAACAAAACCTTTTCTAATCCTCTCGCTATT
GGAGTCGGTGACTTT
Transcript >Ophio5|2376
ATGCTCCTCAGTTTGTCTCGGGGTGGTATTCTGGGAGTCTTGCTGGTTGGGCGGGTTCTAGCCACAGACAAAGCC
TGCCTCCAAGAGTGCCTGCAATCGACTGGAGTCCCTTCCTTCTTCAAAGACCAAGCCGAGTTTGCAAATTTGTCT
AGCCCCTACAATGTCCGCTTGCCATTCACCCCGGCGGCCGTGGTCACAGCCGCGAGCGCTGATCACGTCTCCGAG
GCTGTCAAATGTGCAGTGCAAGCTAGAAGTGGTGGCAACTCGTATGCATCTCACAGCTTGGGTGGCCAAAATGGT
AGTCTCATCATCGATTTGGCTTCCATGAACCAGGTCAAGGTCAACGAAGACATGTCTGCCGAGGTTGGTGGCGGC
GTGCGTTTAGGAAACCTTGACAGGGCCCTCTTCGACCAGGGAAAGCGTGCCATGAGCCACGGTACTTGCGCCAAC
GTTGGCTTTGGCGGTCATAGTCTGCATGGCGGCTACGGCTACGATTCCCGACTGTGGGGGTTGTCCCTGGATCAT
ATACAATCGGTCCAAGTAGTCCTTGCTAACGGCACGATCTCAGACGCTTCACCCACCCAGAACGAAGACTTATTC
TGGGCAGTCCGAGGAGCTGGCGAGTCCATGGGAGTCGTCACCAAGTTTAAAATACGCACGCAGCCCGCACCGGAA
TCCCTCGTCTACTGGATATTCAATTTCAGTGACATAGTCAAGGATATCCCAACCACGGTTGCGGCGCTCGAGCAC
ATCCAGAACTTTGCTCTAAACAAAACCGTGCAAGATCGGCGTTCGTCCTGGGGGTGGTATCTGGGTCGGCAAAGG
TTCAAGCTTCGGGGGAAGTTCCATGGGCCACTCGACGAATTCAACCAACGAATCGCCCCCGAAATCTTACGCGGC
TTCCCAAATCTTGCCGAGGACTCTCGGTATGTACGCCAAGTCAATTGGCTTCAAAGCCAAGCACTCTACCATCAT
GGTTCCGACGATATCTCGCAGCTCTCTCAACCACATGAGCCCGGGGAGTACTCAACTCAGGAGAACTTCTACGCA
AAGTCCCTTACTGTTGCAGGTCCCTTGACGAAGGATGCTATAACCGCCTACGTTACCTTTGCCGCTACGGAAGGG
GCAAAGGTAAAGGAATCTTCCATCTGGTACAGCATTGGCAACCTCTACGGTGGCCCAGATAGCCAGATCGACATT
TACGACAGCTCGTGGTCGTCTTATGGGAATCGGCAGTCAATGTGGGTGTTTCAGAATCATGGTACCGTCGACTTA
GAGGAACCCTTCGACACTTCCCTGCCCGATTATCTCCAAGGCCTAAACGATGCTACGACGAGATACGTGCCGCCC
ACCCAGTTTGGGGCGTATGCGAACTATATCGATCCAGGTTTAAGTGCCAGGGATGCTCACAATCTCTACTACGGC
GATCTCTATCCCCGGCTGCTTAGGATAAAGAAAAGTATTGATCCTAACAAAACCTTTTCTAATCCTCTCGCTATT
GGAGTCGGTGACTTTTAG
Gene >Ophio5|2376
ATGCTCCTCAGTTTGTCTCGGGGTGGTATTCTGGGAGTCTTGCTGGTTGGGCGGGTTCTAGCCACAGACAAAGCC
TGCCTCCAAGAGTGCCTGCAATCGACTGGAGTCCCTTCCTTCTTCAAAGACCAAGCCGAGTTTGCAAATTTGTCT
AGCCCCTACAATGTCCGCTTGCCATTCACCCCGGCGGCCGTGGTCACAGCCGCGAGCGCTGATCACGTCTCCGAG
GCTGTCAAATGTGCAGTAAGATGCGGGGGCTTCAAGGTGTATACTGCTTCTCTTCCTTTGACCTGAGCGGTTCTC
GACTAATAGTTGTAGGTGCAAGCTAGAAGTGGTGGCAACTCGTATGCATCTCACAGCTTGGGTGGCCAAAATGGT
AGTCTCATCATCGATTTGGCTTCCATGAACCAGGTCAAGGTCAACGAAGACATGTCTGCCGAGGTTGGTGGCGGC
GTGCGTTTAGGAAACCTTGACAGGGCCCTCTTCGACCAGGGAAAGCGTGCCATGAGCCACGGTACTTGCGCCAAC
GTTGGCTTTGGCGGTCATAGTCTGCATGGCGGCTACGGCTACGATTCCCGACTGTGGGGGTTGTCCCTGGATCAT
ATACAATCGGTCCAAGTAGTCCTTGCTAACGGCACGATCTCAGACGCTTCACCCACCCAGAACGAAGACTTATTC
TGGGCAGTCCGAGGAGCTGGCGAGTCCATGGGAGTCGTCACCAAGTTTAAAATACGCACGCAGCCCGCACCGGAA
TCCCTCGTCTACTGGATATTCAATTTCAGTGACATAGTCAAGGATATCCCAACCACGGTTGCGGCGCTCGAGCAC
ATCCAGAACTTTGCTCTAAACAAAACCGTGCAAGATCGGCGTTCGTCCTGGGGGTGGTATCTGGGTCGGCAAAGG
TTCAAGCTTCGGGGGAAGTTCCATGGGCCACTCGACGAATTCAACCAACGAATCGCCCCCGAAATCTTACGCGGC
TTCCCAAATCTTGCCGAGGACTCTCGGTATGTACGCCAAGTCAATTGGCTTCAAAGCCAAGCACTCTACCATCAT
GGTTCCGACGATATCTCGCAGCTCTCTCAACCACATGAGCCCGGGGAGTACTCAACTCAGGAGAACTTCTACGCA
AAGTCCCTTACTGTTGCAGGTCCCTTGACGAAGGATGCTATAACCGCCTACGTTACCTTTGCCGCTACGGAAGGG
GCAAAGGTAAAGGAATCTTCCATCTGGTACAGCATTGGCAACCTCTACGGTGGCCCAGATAGCCAGATCGACATT
TACGACAGCTCGTGGTCGTCTTATGGGAATCGGCAGTCAATGTGGGTGTTTCAGAATCATGGTACCGTCGACTTA
GAGGAACCCTTCGACACTTCCCTGCCCGATTATCTCCAAGGCCTAAACGATGCTACGACGAGATACGTGCCGCCC
ACCCAGTTTGGGGCGTATGCGAACTATATCGATCCAGGTTTAAGTGCCAGGGATGCTCACAATCTCTACTACGGC
GATCTCTATCCCCGGCTGCTTAGGATAAAGAAAAGTATTGATCCTAACAAAACCTTTTCTAATCCTCTCGCTATT
GGAGTCGGTGACTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail