Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|237
Gene name
Locationscaffold_1046:1965..3470
Strand-
Gene length (bp)1505
Transcript length (bp)1452
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12998 ING Inhibitor of growth proteins N-terminal histone-binding 1.9E-22 26 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VEK6|ING3_MOUSE Inhibitor of growth protein 3 OS=Mus musculus GN=Ing3 PE=1 SV=2 24 425 5.0E-19
sp|Q498T3|ING3_RAT Inhibitor of growth protein 3 OS=Rattus norvegicus GN=Ing3 PE=2 SV=1 24 425 4.0E-18
sp|Q9NXR8|ING3_HUMAN Inhibitor of growth protein 3 OS=Homo sapiens GN=ING3 PE=1 SV=2 24 425 9.0E-18
sp|Q66KD5|ING3_XENTR Inhibitor of growth protein 3 OS=Xenopus tropicalis GN=ing3 PE=2 SV=1 24 425 2.0E-17
sp|Q6C5V7|YNG2_YARLI Chromatin modification-related protein YNG2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YNG2 PE=3 SV=1 20 159 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8VEK6|ING3_MOUSE Inhibitor of growth protein 3 OS=Mus musculus GN=Ing3 PE=1 SV=2 24 425 5.0E-19
sp|Q498T3|ING3_RAT Inhibitor of growth protein 3 OS=Rattus norvegicus GN=Ing3 PE=2 SV=1 24 425 4.0E-18
sp|Q9NXR8|ING3_HUMAN Inhibitor of growth protein 3 OS=Homo sapiens GN=ING3 PE=1 SV=2 24 425 9.0E-18
sp|Q66KD5|ING3_XENTR Inhibitor of growth protein 3 OS=Xenopus tropicalis GN=ing3 PE=2 SV=1 24 425 2.0E-17
sp|Q6C5V7|YNG2_YARLI Chromatin modification-related protein YNG2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YNG2 PE=3 SV=1 20 159 2.0E-16
sp|O42871|ING1_SCHPO Chromatin modification-related protein png1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=png1 PE=3 SV=1 277 425 6.0E-16
sp|O42871|ING1_SCHPO Chromatin modification-related protein png1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=png1 PE=3 SV=1 21 124 6.0E-16
sp|Q08465|YNG1_YEAST Protein YNG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNG1 PE=1 SV=1 376 425 2.0E-15
sp|Q9QXV3|ING1_MOUSE Inhibitor of growth protein 1 OS=Mus musculus GN=Ing1 PE=2 SV=1 386 425 3.0E-14
sp|Q6FSB1|YNG2_CANGA Chromatin modification-related protein YNG2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YNG2 PE=3 SV=1 275 425 7.0E-14
sp|Q6BNL6|YNG2_DEBHA Chromatin modification-related protein YNG2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YNG2 PE=3 SV=1 20 251 7.0E-14
sp|Q9LIQ6|ING1_ARATH PHD finger protein ING1 OS=Arabidopsis thaliana GN=ING1 PE=1 SV=1 386 425 8.0E-14
sp|Q9D8Y8|ING5_MOUSE Inhibitor of growth protein 5 OS=Mus musculus GN=Ing5 PE=1 SV=1 386 425 9.0E-14
sp|Q9ESK4|ING2_MOUSE Inhibitor of growth protein 2 OS=Mus musculus GN=Ing2 PE=1 SV=3 386 425 1.0E-13
sp|Q5ZKY4|ING4_CHICK Inhibitor of growth protein 4 OS=Gallus gallus GN=ING4 PE=2 SV=1 386 425 1.0E-13
sp|Q8WYH8|ING5_HUMAN Inhibitor of growth protein 5 OS=Homo sapiens GN=ING5 PE=1 SV=1 386 425 1.0E-13
sp|Q9H160|ING2_HUMAN Inhibitor of growth protein 2 OS=Homo sapiens GN=ING2 PE=1 SV=2 386 425 1.0E-13
sp|Q8C0D7|ING4_MOUSE Inhibitor of growth protein 4 OS=Mus musculus GN=Ing4 PE=1 SV=2 386 425 1.0E-13
sp|Q9UNL4|ING4_HUMAN Inhibitor of growth protein 4 OS=Homo sapiens GN=ING4 PE=1 SV=1 386 425 1.0E-13
sp|Q6FSB1|YNG2_CANGA Chromatin modification-related protein YNG2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YNG2 PE=3 SV=1 20 167 1.0E-13
sp|Q5RBA1|ING3_PONAB Inhibitor of growth protein 3 OS=Pongo abelii GN=ING3 PE=2 SV=1 385 425 3.0E-13
sp|Q5ZK36|ING3_CHICK Inhibitor of growth protein 3 OS=Gallus gallus GN=ING3 PE=2 SV=1 385 425 3.0E-13
sp|P38806|YNG2_YEAST Chromatin modification-related protein YNG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNG2 PE=1 SV=1 372 425 5.0E-13
sp|Q5AHB8|YNG2_CANAL Chromatin modification-related protein YNG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YNG2 PE=3 SV=2 379 421 8.0E-13
sp|Q6C5V7|YNG2_YARLI Chromatin modification-related protein YNG2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YNG2 PE=3 SV=1 300 425 8.0E-13
sp|Q5AHB8|YNG2_CANAL Chromatin modification-related protein YNG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YNG2 PE=3 SV=2 20 207 1.0E-12
sp|Q757W2|YNG2_ASHGO Chromatin modification-related protein YNG2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YNG2 PE=3 SV=1 312 425 1.0E-12
sp|Q6BNL6|YNG2_DEBHA Chromatin modification-related protein YNG2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YNG2 PE=3 SV=1 379 421 2.0E-12
sp|Q9UK53|ING1_HUMAN Inhibitor of growth protein 1 OS=Homo sapiens GN=ING1 PE=1 SV=2 382 425 2.0E-12
sp|Q6CXN0|YNG2_KLULA Chromatin modification-related protein YNG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YNG2 PE=3 SV=1 379 425 5.0E-12
sp|Q3T095|ING4_BOVIN Inhibitor of growth protein 4 OS=Bos taurus GN=ING4 PE=2 SV=1 386 425 6.0E-12
sp|O74736|ING2_SCHPO Chromatin modification-related protein png2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=png2 PE=1 SV=1 383 425 3.0E-11
sp|B3H615|ING2_ARATH PHD finger protein ING2 OS=Arabidopsis thaliana GN=ING2 PE=1 SV=1 363 425 5.0E-11
sp|Q757W2|YNG2_ASHGO Chromatin modification-related protein YNG2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YNG2 PE=3 SV=1 14 134 3.0E-10
sp|P50947|PHO23_YEAST Transcriptional regulatory protein PHO23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO23 PE=1 SV=1 386 425 6.0E-10
sp|P38806|YNG2_YEAST Chromatin modification-related protein YNG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNG2 PE=1 SV=1 20 134 1.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 454 476 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|237
MPRDDLTIDFVKTMPQAEPLDPALILDDWINRVHNLPEEIRFMQDEIADKDRIYNECIRSIEDRDDKIQKWIKSN
GSLEPNPKEDLLRTQIHEYYTRADQISEEKIALARRLQVIVDKYIRSLDVQIKLLYDRGEPGFTDPDEVPSLLRP
SAANHAAPSDRSVNPATAIVATLGPTSSPSIAARSSSNPTATRLPAHPQIRSAQAQQAHPQHALSAPVTPAAGIT
HSRQRETSAGPAMKRGPRSNAGPGNTLAASTGLSRHSSLGPGTSKSGPPVGPAGGIVRAGSAGPRAGPVKAASGS
GSRRGTPTATARKRTVHKSSLSRVKKMSARSSPASTADSDLSEAESVSGDEDKGTEALSRVTPPVDNKRIVGDAE
DDEEGGDDKKYCLCHNVSYGKMVACDNESCPFEWFHWTCVGLKSEPNGTWEGFGEASLEKGHLELKLEPGQRSTV
DTPTFYFFFFCKGLAAACYPINLFACAHGKATM
Coding >Ophio5|237
ATGCCTAGAGACGATTTAACCATCGACTTTGTCAAGACAATGCCCCAAGCGGAGCCACTCGACCCTGCATTGATC
CTTGACGATTGGATCAATCGCGTTCATAACCTTCCTGAGGAAATACGCTTTATGCAGGACGAGATAGCAGACAAG
GATCGCATTTACAATGAGTGCATCCGTTCGATTGAAGATCGCGATGACAAGATTCAAAAGTGGATCAAGTCCAAC
GGCAGCCTCGAGCCGAATCCCAAGGAAGATCTTTTGCGTACTCAGATTCATGAGTACTATACTCGCGCCGATCAA
ATATCTGAGGAAAAGATTGCACTGGCCCGGAGACTGCAAGTCATCGTGGACAAGTATATACGTAGCCTCGACGTG
CAGATTAAACTTCTTTATGATCGCGGAGAACCTGGCTTCACAGATCCTGACGAGGTGCCCTCGCTCCTGCGTCCC
AGCGCTGCTAATCACGCCGCCCCTTCTGACCGTTCTGTCAACCCTGCTACCGCCATAGTCGCCACCCTCGGCCCG
ACCTCTTCGCCGTCAATTGCAGCGCGCAGCTCGTCCAACCCAACGGCGACGCGTTTGCCGGCGCATCCACAGATC
AGAAGCGCCCAAGCTCAACAGGCACACCCTCAACACGCATTATCTGCGCCCGTCACGCCGGCGGCTGGCATCACC
CATAGCCGACAACGCGAAACCTCTGCCGGCCCCGCGATGAAACGTGGCCCGCGATCCAACGCGGGACCGGGAAAC
ACGCTCGCAGCGTCGACCGGTCTATCGAGACATTCCTCGCTCGGCCCCGGAACATCCAAGAGTGGACCTCCTGTC
GGCCCAGCAGGCGGTATCGTGAGGGCTGGTAGTGCGGGCCCACGCGCTGGCCCAGTCAAGGCAGCATCTGGGTCT
GGCAGCAGACGGGGCACACCCACCGCGACAGCCCGAAAGAGGACGGTTCACAAATCCTCGCTCTCGCGAGTGAAG
AAGATGTCGGCCAGGAGCTCGCCAGCCTCGACGGCAGATAGCGACTTGTCGGAGGCCGAGAGTGTCAGTGGCGAT
GAAGATAAAGGCACCGAAGCTCTATCTAGAGTTACCCCGCCAGTCGATAACAAAAGAATCGTGGGAGACGCTGAG
GATGACGAAGAAGGCGGCGATGATAAGAAGTATTGCCTGTGTCACAACGTGAGTTACGGCAAAATGGTGGCTTGT
GATAACGAAAGCTGCCCCTTTGAATGGTTCCATTGGACTTGCGTTGGGCTTAAGAGCGAGCCCAATGGAACCTGG
GAAGGATTTGGCGAAGCGAGTCTGGAGAAGGGTCATCTTGAATTGAAGTTGGAGCCAGGACAGCGATCAACAGTG
GATACCCCCACTTTTTACTTCTTCTTTTTCTGCAAGGGTTTAGCAGCTGCCTGTTACCCAATTAACTTGTTTGCG
TGTGCCCATGGTAAAGCCACGATG
Transcript >Ophio5|237
ATGCCTAGAGACGATTTAACCATCGACTTTGTCAAGACAATGCCCCAAGCGGAGCCACTCGACCCTGCATTGATC
CTTGACGATTGGATCAATCGCGTTCATAACCTTCCTGAGGAAATACGCTTTATGCAGGACGAGATAGCAGACAAG
GATCGCATTTACAATGAGTGCATCCGTTCGATTGAAGATCGCGATGACAAGATTCAAAAGTGGATCAAGTCCAAC
GGCAGCCTCGAGCCGAATCCCAAGGAAGATCTTTTGCGTACTCAGATTCATGAGTACTATACTCGCGCCGATCAA
ATATCTGAGGAAAAGATTGCACTGGCCCGGAGACTGCAAGTCATCGTGGACAAGTATATACGTAGCCTCGACGTG
CAGATTAAACTTCTTTATGATCGCGGAGAACCTGGCTTCACAGATCCTGACGAGGTGCCCTCGCTCCTGCGTCCC
AGCGCTGCTAATCACGCCGCCCCTTCTGACCGTTCTGTCAACCCTGCTACCGCCATAGTCGCCACCCTCGGCCCG
ACCTCTTCGCCGTCAATTGCAGCGCGCAGCTCGTCCAACCCAACGGCGACGCGTTTGCCGGCGCATCCACAGATC
AGAAGCGCCCAAGCTCAACAGGCACACCCTCAACACGCATTATCTGCGCCCGTCACGCCGGCGGCTGGCATCACC
CATAGCCGACAACGCGAAACCTCTGCCGGCCCCGCGATGAAACGTGGCCCGCGATCCAACGCGGGACCGGGAAAC
ACGCTCGCAGCGTCGACCGGTCTATCGAGACATTCCTCGCTCGGCCCCGGAACATCCAAGAGTGGACCTCCTGTC
GGCCCAGCAGGCGGTATCGTGAGGGCTGGTAGTGCGGGCCCACGCGCTGGCCCAGTCAAGGCAGCATCTGGGTCT
GGCAGCAGACGGGGCACACCCACCGCGACAGCCCGAAAGAGGACGGTTCACAAATCCTCGCTCTCGCGAGTGAAG
AAGATGTCGGCCAGGAGCTCGCCAGCCTCGACGGCAGATAGCGACTTGTCGGAGGCCGAGAGTGTCAGTGGCGAT
GAAGATAAAGGCACCGAAGCTCTATCTAGAGTTACCCCGCCAGTCGATAACAAAAGAATCGTGGGAGACGCTGAG
GATGACGAAGAAGGCGGCGATGATAAGAAGTATTGCCTGTGTCACAACGTGAGTTACGGCAAAATGGTGGCTTGT
GATAACGAAAGCTGCCCCTTTGAATGGTTCCATTGGACTTGCGTTGGGCTTAAGAGCGAGCCCAATGGAACCTGG
GAAGGATTTGGCGAAGCGAGTCTGGAGAAGGGTCATCTTGAATTGAAGTTGGAGCCAGGACAGCGATCAACAGTG
GATACCCCCACTTTTTACTTCTTCTTTTTCTGCAAGGGTTTAGCAGCTGCCTGTTACCCAATTAACTTGTTTGCG
TGTGCCCATGGTAAAGCCACGATGTAA
Gene >Ophio5|237
ATGCCTAGAGACGATTTAACCATCGACTTTGTCAAGACAATGCCCCAAGCGGAGCCACTCGACCCTGCATTGATC
CTTGACGATTGGATCAATCGCGTTCATAACCTTCCTGAGGAAATACGCTTTATGCAGGACGAGATAGCAGACAAG
GATCGCATTTACAATGAGTGCATCCGTTCGATTGAAGATCGCGATGACAAGATTCAAAAGTGGATCAAGTCCAAC
GGCAGCCTCGAGCCGAATCCCAAGGAAGATCTTTTGCGTACTCAGATTCATGAGTACTATACTCGCGCCGATCAA
ATATCTGAGGAAAAGATTGCACTGGCCCGGAGACTGCAAGTCATCGTGGACAAGTATATACGTAGCCTCGACGTG
CAGATTAAACTTCTTTATGATCGCGGAGAACCTGGCTTCACAGATCCTGACGAGGTGCCCTCGCTCCTGCGTCCC
AGCGCTGCTAATCACGCCGCCCCTTCTGACCGTTCTGTCAACCCTGCTACCGCCATAGTCGCCACCCTCGGCCCG
ACCTCTTCGCCGTCAATTGCAGCGCGCAGCTCGTCCAACCCAACGGCGACGCGTTTGCCGGCGCATCCACAGATC
AGAAGCGCCCAAGCTCAACAGGCACACCCTCAACACGCATTATCTGCGCCCGTCACGCCGGCGGCTGGCATCACC
CATAGCCGACAACGCGAAACCTCTGCCGGCCCCGCGATGAAACGTGGCCCGCGATCCAACGCGGGACCGGGAAAC
ACGCTCGCAGCGTCGACCGGTCTATCGAGACATTCCTCGCTCGGCCCCGGAACATCCAAGAGTGGACCTCCTGTC
GGCCCAGCAGGCGGTATCGTGAGGGCTGGTAGTGCGGGCCCACGCGCTGGCCCAGTCAAGGCAGCATCTGGGTCT
GGCAGCAGACGGGGCACACCCACCGCGACAGCCCGAAAGAGGACGGTTCACAAATCCTCGCTCTCGCGAGTGAAG
AAGATGTCGGCCAGGAGCTCGCCAGCCTCGACGGCAGATAGCGACTTGTCGGAGGCCGAGAGTGTCAGTGGCGAT
GAAGATAAAGGCACCGAAGCTCTATCTAGAGTTACCCCGCCAGTCGATAACAAAAGAATCGTGGGAGACGCTGAG
GATGACGAAGAAGGCGGCGATGATAAGAAGTATTGCCTGTGTCACAACGTGAGTTACGGCAAAATGGTGGCTTGT
GATAACGAAAGCTGCCCCTTTGAATGGTTCCATTGGACTTGCGTTGGGCTTAAGAGCGAGCCCAATGGAACCTGG
TACTGCCCTGTCTGCACGGAGAAGTGTATTAAGAAGACTAAATGACCAACAGGGAAGGATTTGGCGAAGCGAGTC
TGGAGAAGGGTCATCTTGAATTGAAGTTGGAGCCAGGACAGCGATCAACAGTGGATACCCCCACTTTTTACTTCT
TCTTTTTCTGCAAGGGTTTAGCAGCTGCCTGTTACCCAATTAACTTGTTTGCGTGTGCCCATGGTAAAGCCACGA
TGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail