Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2368
Gene name
Locationscaffold_2:95353..96880
Strand+
Gene length (bp)1527
Transcript length (bp)1527
Coding sequence length (bp)1524
Protein length (aa) 508

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01974 tRNA_int_endo tRNA intron endonuclease, catalytic C-terminal domain 1.2E-18 384 470

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6Y2|SEN2_NEUCR Probable tRNA-splicing endonuclease subunit tsp-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tsp-2 PE=3 SV=1 12 508 9.0E-138
sp|Q8TFH7|SEN2_SCHPO Probable tRNA-splicing endonuclease subunit sen2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen2 PE=3 SV=1 320 508 1.0E-27
sp|Q5ZIN2|SEN2_CHICK tRNA-splicing endonuclease subunit Sen2 OS=Gallus gallus GN=TSEN2 PE=2 SV=1 81 508 1.0E-25
sp|Q74ZY5|SEN2_ASHGO tRNA-splicing endonuclease subunit SEN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEN2 PE=3 SV=2 322 508 3.0E-22
sp|P16658|SEN2_YEAST tRNA-splicing endonuclease subunit SEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN2 PE=1 SV=1 308 508 4.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6Y2|SEN2_NEUCR Probable tRNA-splicing endonuclease subunit tsp-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tsp-2 PE=3 SV=1 12 508 9.0E-138
sp|Q8TFH7|SEN2_SCHPO Probable tRNA-splicing endonuclease subunit sen2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen2 PE=3 SV=1 320 508 1.0E-27
sp|Q5ZIN2|SEN2_CHICK tRNA-splicing endonuclease subunit Sen2 OS=Gallus gallus GN=TSEN2 PE=2 SV=1 81 508 1.0E-25
sp|Q74ZY5|SEN2_ASHGO tRNA-splicing endonuclease subunit SEN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEN2 PE=3 SV=2 322 508 3.0E-22
sp|P16658|SEN2_YEAST tRNA-splicing endonuclease subunit SEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN2 PE=1 SV=1 308 508 4.0E-22
sp|Q6P7W5|SEN2_MOUSE tRNA-splicing endonuclease subunit Sen2 OS=Mus musculus GN=Tsen2 PE=1 SV=1 322 508 3.0E-21
sp|Q8NCE0|SEN2_HUMAN tRNA-splicing endonuclease subunit Sen2 OS=Homo sapiens GN=TSEN2 PE=1 SV=2 322 508 8.0E-21
sp|Q5M954|SEN2_RAT tRNA-splicing endonuclease subunit Sen2 OS=Rattus norvegicus GN=Tsen2 PE=1 SV=1 322 508 8.0E-21
sp|Q9M1E8|SEN21_ARATH tRNA-splicing endonuclease subunit Sen2-1 OS=Arabidopsis thaliana GN=SEN1 PE=2 SV=1 320 508 2.0E-15
sp|P16658|SEN2_YEAST tRNA-splicing endonuclease subunit SEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN2 PE=1 SV=1 19 156 2.0E-13
sp|Q5Z6B1|SEN2_ORYSJ Probable tRNA-splicing endonuclease subunit Sen2 OS=Oryza sativa subsp. japonica GN=Os06g0530700 PE=2 SV=1 311 469 5.0E-13
sp|Q9LSS3|SEN22_ARATH tRNA-splicing endonuclease subunit Sen2-2 OS=Arabidopsis thaliana GN=SEN2 PE=2 SV=1 321 503 3.0E-12
sp|Q8TFH7|SEN2_SCHPO Probable tRNA-splicing endonuclease subunit sen2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen2 PE=3 SV=1 25 162 1.0E-10
sp|Q74ZY5|SEN2_ASHGO tRNA-splicing endonuclease subunit SEN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEN2 PE=3 SV=2 28 159 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006388 tRNA splicing, via endonucleolytic cleavage and ligation Yes
GO:0000213 tRNA-intron endonuclease activity Yes
GO:0090304 nucleic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0004549 tRNA-specific ribonuclease activity No
GO:0046483 heterocycle metabolic process No
GO:0008033 tRNA processing No
GO:0043170 macromolecule metabolic process No
GO:0004518 nuclease activity No
GO:0044238 primary metabolic process No
GO:0004521 endoribonuclease activity No
GO:0008380 RNA splicing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0016892 endoribonuclease activity, producing 3'-phosphomonoesters No
GO:0006399 tRNA metabolic process No
GO:0004540 ribonuclease activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016894 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 3'-phosphomonoesters No
GO:0003824 catalytic activity No
GO:0034660 ncRNA metabolic process No
GO:0034470 ncRNA processing No
GO:0006807 nitrogen compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0006396 RNA processing No
GO:0016070 RNA metabolic process No
GO:0004519 endonuclease activity No
GO:0016787 hydrolase activity No
GO:0009987 cellular process No
GO:0140101 catalytic activity, acting on a tRNA No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4447 0.4966 0.0436 0.0042 0.2763 0.0897 0.3998 0.1038 0.2533 0.1488

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup218
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2592
Ophiocordyceps australis 1348a (Ghana) OphauG2|2593
Ophiocordyceps australis map64 (Brazil) OphauB2|1721
Ophiocordyceps australis map64 (Brazil) OphauB2|1722
Ophiocordyceps camponoti-floridani Ophcf2|05298
Ophiocordyceps camponoti-floridani Ophcf2|05299
Ophiocordyceps camponoti-rufipedis Ophun1|359
Ophiocordyceps kimflemingae Ophio5|2368 (this protein)
Ophiocordyceps kimflemingae Ophio5|2369
Ophiocordyceps subramaniannii Hirsu2|2316
Ophiocordyceps subramaniannii Hirsu2|2317

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2368
MAEVNGSSQEPNPGRKGASRGPSIHQIYSLPVPIRTFPLPTFYPDNPLSLFHVASAWLGQLFSPPPAEPAVIHCG
VWSEATTSVHVKDEKSMRALWEQGFYGKGNLSRSEPNWLKRERVRRGLQEVHVSELLTLQRREERAQAKWERARL
EQEAIQNTRLEEARQEAARRQAETEMSLPAAPVGPLQLLSLPNSHVEILRARPVLAREPEVVGRPSSEGWGGMNA
VHLADPAADGEGSHEHQLNSKHIECSEASNDSTSVKRPKSVRFSPRVESTTFKLSDPPSPDHVPAANCRSPDAES
SVAAPVSDGNGSTGEQELVNREHLQLMPEEAFFLCFGLGALRVSEPGSEEALSTRQMLTRFRQYSYFPPRIGPEE
SELEADDGFLVHYAVYHHFRSLGWVPRAGIKFGVDWLLYTRGPVFDHAEFGVIVIPSYSDVWWDRSDKGKTWAWL
HGVVRVLSHVMKSLVLVYVEVPATPRLEEALKAGIGEAMALYKVREVTVKRWSSNRNR
Coding >Ophio5|2368
ATGGCTGAGGTCAACGGTTCATCCCAAGAGCCCAACCCTGGCAGAAAGGGAGCTTCGCGCGGGCCTTCGATCCAT
CAGATATACTCGCTGCCTGTCCCTATCAGGACATTTCCTCTTCCGACCTTTTACCCCGATAACCCGCTCTCGCTC
TTCCACGTTGCCTCGGCATGGCTGGGCCAGCTCTTCTCTCCGCCTCCCGCTGAGCCGGCCGTCATCCACTGCGGG
GTGTGGTCCGAGGCCACGACGTCTGTTCACGTCAAGGATGAGAAATCGATGAGGGCTCTATGGGAGCAGGGCTTC
TACGGCAAAGGCAACCTGAGCCGTAGCGAGCCCAACTGGCTGAAGCGAGAGCGCGTCCGGAGAGGGCTGCAAGAA
GTTCACGTCAGTGAGCTTCTGACCTTGCAGAGACGCGAAGAGCGCGCGCAGGCCAAGTGGGAACGGGCGAGGCTG
GAGCAGGAAGCGATTCAAAATACGAGGTTGGAGGAGGCGCGCCAAGAGGCCGCTCGTCGTCAAGCTGAAACAGAA
ATGTCGCTCCCTGCGGCACCCGTCGGCCCGCTCCAGCTGCTTTCGCTGCCCAACTCGCACGTTGAGATACTACGC
GCCAGGCCGGTCCTGGCGAGAGAGCCAGAAGTCGTCGGGAGACCCAGCTCAGAGGGTTGGGGGGGAATGAATGCC
GTCCATCTTGCCGATCCTGCAGCCGATGGCGAGGGATCGCACGAGCATCAGCTCAATAGCAAGCACATTGAGTGC
TCCGAAGCCTCGAACGATTCCACGTCGGTAAAACGACCGAAGAGCGTTCGCTTTTCTCCGCGGGTAGAATCGACG
ACATTCAAGCTGTCGGATCCTCCAAGTCCCGACCACGTACCGGCAGCGAACTGTCGCAGCCCGGATGCTGAGAGC
TCAGTCGCGGCTCCAGTGTCAGATGGCAATGGCTCGACTGGGGAGCAGGAGCTGGTCAACCGAGAGCACCTGCAG
CTGATGCCCGAAGAGGCCTTCTTTCTTTGCTTCGGACTGGGGGCTCTTCGTGTCTCGGAGCCTGGATCTGAGGAG
GCTCTGTCGACGAGGCAAATGTTGACACGCTTCCGGCAATACTCCTACTTTCCGCCGAGGATTGGACCAGAGGAG
TCGGAGCTAGAAGCTGACGACGGGTTCCTGGTCCACTACGCCGTCTACCACCACTTCCGTTCGCTCGGCTGGGTA
CCACGGGCAGGCATCAAGTTTGGGGTGGACTGGCTGCTGTACACCAGGGGGCCGGTGTTTGACCACGCCGAGTTT
GGCGTCATCGTCATACCTTCGTACTCTGACGTTTGGTGGGACAGATCGGACAAGGGAAAGACATGGGCGTGGCTT
CACGGCGTTGTACGAGTATTGTCGCACGTGATGAAGAGCCTGGTGCTCGTGTACGTCGAGGTGCCGGCCACGCCG
AGGTTGGAAGAGGCGCTGAAGGCCGGTATCGGGGAGGCCATGGCGCTGTACAAGGTGAGGGAGGTGACGGTGAAG
CGGTGGTCAAGCAACCGGAACCGG
Transcript >Ophio5|2368
ATGGCTGAGGTCAACGGTTCATCCCAAGAGCCCAACCCTGGCAGAAAGGGAGCTTCGCGCGGGCCTTCGATCCAT
CAGATATACTCGCTGCCTGTCCCTATCAGGACATTTCCTCTTCCGACCTTTTACCCCGATAACCCGCTCTCGCTC
TTCCACGTTGCCTCGGCATGGCTGGGCCAGCTCTTCTCTCCGCCTCCCGCTGAGCCGGCCGTCATCCACTGCGGG
GTGTGGTCCGAGGCCACGACGTCTGTTCACGTCAAGGATGAGAAATCGATGAGGGCTCTATGGGAGCAGGGCTTC
TACGGCAAAGGCAACCTGAGCCGTAGCGAGCCCAACTGGCTGAAGCGAGAGCGCGTCCGGAGAGGGCTGCAAGAA
GTTCACGTCAGTGAGCTTCTGACCTTGCAGAGACGCGAAGAGCGCGCGCAGGCCAAGTGGGAACGGGCGAGGCTG
GAGCAGGAAGCGATTCAAAATACGAGGTTGGAGGAGGCGCGCCAAGAGGCCGCTCGTCGTCAAGCTGAAACAGAA
ATGTCGCTCCCTGCGGCACCCGTCGGCCCGCTCCAGCTGCTTTCGCTGCCCAACTCGCACGTTGAGATACTACGC
GCCAGGCCGGTCCTGGCGAGAGAGCCAGAAGTCGTCGGGAGACCCAGCTCAGAGGGTTGGGGGGGAATGAATGCC
GTCCATCTTGCCGATCCTGCAGCCGATGGCGAGGGATCGCACGAGCATCAGCTCAATAGCAAGCACATTGAGTGC
TCCGAAGCCTCGAACGATTCCACGTCGGTAAAACGACCGAAGAGCGTTCGCTTTTCTCCGCGGGTAGAATCGACG
ACATTCAAGCTGTCGGATCCTCCAAGTCCCGACCACGTACCGGCAGCGAACTGTCGCAGCCCGGATGCTGAGAGC
TCAGTCGCGGCTCCAGTGTCAGATGGCAATGGCTCGACTGGGGAGCAGGAGCTGGTCAACCGAGAGCACCTGCAG
CTGATGCCCGAAGAGGCCTTCTTTCTTTGCTTCGGACTGGGGGCTCTTCGTGTCTCGGAGCCTGGATCTGAGGAG
GCTCTGTCGACGAGGCAAATGTTGACACGCTTCCGGCAATACTCCTACTTTCCGCCGAGGATTGGACCAGAGGAG
TCGGAGCTAGAAGCTGACGACGGGTTCCTGGTCCACTACGCCGTCTACCACCACTTCCGTTCGCTCGGCTGGGTA
CCACGGGCAGGCATCAAGTTTGGGGTGGACTGGCTGCTGTACACCAGGGGGCCGGTGTTTGACCACGCCGAGTTT
GGCGTCATCGTCATACCTTCGTACTCTGACGTTTGGTGGGACAGATCGGACAAGGGAAAGACATGGGCGTGGCTT
CACGGCGTTGTACGAGTATTGTCGCACGTGATGAAGAGCCTGGTGCTCGTGTACGTCGAGGTGCCGGCCACGCCG
AGGTTGGAAGAGGCGCTGAAGGCCGGTATCGGGGAGGCCATGGCGCTGTACAAGGTGAGGGAGGTGACGGTGAAG
CGGTGGTCAAGCAACCGGAACCGGTGA
Gene >Ophio5|2368
ATGGCTGAGGTCAACGGTTCATCCCAAGAGCCCAACCCTGGCAGAAAGGGAGCTTCGCGCGGGCCTTCGATCCAT
CAGATATACTCGCTGCCTGTCCCTATCAGGACATTTCCTCTTCCGACCTTTTACCCCGATAACCCGCTCTCGCTC
TTCCACGTTGCCTCGGCATGGCTGGGCCAGCTCTTCTCTCCGCCTCCCGCTGAGCCGGCCGTCATCCACTGCGGG
GTGTGGTCCGAGGCCACGACGTCTGTTCACGTCAAGGATGAGAAATCGATGAGGGCTCTATGGGAGCAGGGCTTC
TACGGCAAAGGCAACCTGAGCCGTAGCGAGCCCAACTGGCTGAAGCGAGAGCGCGTCCGGAGAGGGCTGCAAGAA
GTTCACGTCAGTGAGCTTCTGACCTTGCAGAGACGCGAAGAGCGCGCGCAGGCCAAGTGGGAACGGGCGAGGCTG
GAGCAGGAAGCGATTCAAAATACGAGGTTGGAGGAGGCGCGCCAAGAGGCCGCTCGTCGTCAAGCTGAAACAGAA
ATGTCGCTCCCTGCGGCACCCGTCGGCCCGCTCCAGCTGCTTTCGCTGCCCAACTCGCACGTTGAGATACTACGC
GCCAGGCCGGTCCTGGCGAGAGAGCCAGAAGTCGTCGGGAGACCCAGCTCAGAGGGTTGGGGGGGAATGAATGCC
GTCCATCTTGCCGATCCTGCAGCCGATGGCGAGGGATCGCACGAGCATCAGCTCAATAGCAAGCACATTGAGTGC
TCCGAAGCCTCGAACGATTCCACGTCGGTAAAACGACCGAAGAGCGTTCGCTTTTCTCCGCGGGTAGAATCGACG
ACATTCAAGCTGTCGGATCCTCCAAGTCCCGACCACGTACCGGCAGCGAACTGTCGCAGCCCGGATGCTGAGAGC
TCAGTCGCGGCTCCAGTGTCAGATGGCAATGGCTCGACTGGGGAGCAGGAGCTGGTCAACCGAGAGCACCTGCAG
CTGATGCCCGAAGAGGCCTTCTTTCTTTGCTTCGGACTGGGGGCTCTTCGTGTCTCGGAGCCTGGATCTGAGGAG
GCTCTGTCGACGAGGCAAATGTTGACACGCTTCCGGCAATACTCCTACTTTCCGCCGAGGATTGGACCAGAGGAG
TCGGAGCTAGAAGCTGACGACGGGTTCCTGGTCCACTACGCCGTCTACCACCACTTCCGTTCGCTCGGCTGGGTA
CCACGGGCAGGCATCAAGTTTGGGGTGGACTGGCTGCTGTACACCAGGGGGCCGGTGTTTGACCACGCCGAGTTT
GGCGTCATCGTCATACCTTCGTACTCTGACGTTTGGTGGGACAGATCGGACAAGGGAAAGACATGGGCGTGGCTT
CACGGCGTTGTACGAGTATTGTCGCACGTGATGAAGAGCCTGGTGCTCGTGTACGTCGAGGTGCCGGCCACGCCG
AGGTTGGAAGAGGCGCTGAAGGCCGGTATCGGGGAGGCCATGGCGCTGTACAAGGTGAGGGAGGTGACGGTGAAG
CGGTGGTCAAGCAACCGGAACCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail