Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2360
Gene name
Locationscaffold_2:77530..78971
Strand-
Gene length (bp)1441
Transcript length (bp)1383
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00450 Peptidase_S10 Serine carboxypeptidase 1.9E-108 51 454

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RXW8|CBPYA_NEUCR Carboxypeptidase Y homolog A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpyA PE=3 SV=1 38 457 2.0E-157
sp|B2AWD5|CBPYA_PODAN Carboxypeptidase Y homolog A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CPYA PE=3 SV=1 38 460 3.0E-157
sp|C7YQJ2|CBPYA_NECH7 Carboxypeptidase Y homolog A OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=CPYA PE=3 SV=1 39 457 5.0E-157
sp|D1ZG13|CBPYA_SORMK Carboxypeptidase Y homolog A OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=CPYA PE=3 SV=1 38 457 4.0E-156
sp|A7F4H5|CBPYA_SCLS1 Carboxypeptidase Y homolog A OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=cpyA PE=3 SV=1 32 454 4.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RXW8|CBPYA_NEUCR Carboxypeptidase Y homolog A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpyA PE=3 SV=1 38 457 2.0E-157
sp|B2AWD5|CBPYA_PODAN Carboxypeptidase Y homolog A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CPYA PE=3 SV=1 38 460 3.0E-157
sp|C7YQJ2|CBPYA_NECH7 Carboxypeptidase Y homolog A OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=CPYA PE=3 SV=1 39 457 5.0E-157
sp|D1ZG13|CBPYA_SORMK Carboxypeptidase Y homolog A OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=CPYA PE=3 SV=1 38 457 4.0E-156
sp|A7F4H5|CBPYA_SCLS1 Carboxypeptidase Y homolog A OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=cpyA PE=3 SV=1 32 454 4.0E-156
sp|D4DLI1|CBPYA_TRIVH Carboxypeptidase Y homolog A OS=Trichophyton verrucosum (strain HKI 0517) GN=cpyA PE=3 SV=1 38 457 1.0E-155
sp|E3QR43|CBPYA_COLGM Carboxypeptidase Y homolog A OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=CPYA PE=3 SV=1 39 457 3.0E-155
sp|B6QAN5|CBPYA_TALMQ Carboxypeptidase Y homolog A OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=cpyA PE=3 SV=1 38 457 3.0E-155
sp|D4AZ71|CBPYA_ARTBC Carboxypeptidase Y homolog A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CPYA PE=3 SV=1 38 457 4.0E-155
sp|B8M044|CBPYA_TALSN Carboxypeptidase Y homolog A OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=cpyA PE=3 SV=1 38 457 5.0E-155
sp|B8XGR4|CBPYA_TRIEQ Carboxypeptidase Y homolog A OS=Trichophyton equinum GN=CPYA PE=3 SV=1 38 457 8.0E-155
sp|C5K1Y9|CBPYA_AJEDS Carboxypeptidase Y homolog A OS=Ajellomyces dermatitidis (strain SLH14081) GN=CPYA PE=3 SV=1 38 460 1.0E-154
sp|A5YCB8|CBPYA_TRITO Carboxypeptidase Y homolog A OS=Trichophyton tonsurans GN=CPYA PE=3 SV=1 38 457 2.0E-154
sp|C5GEU5|CBPYA_AJEDR Carboxypeptidase Y homolog A OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=CPYA PE=3 SV=1 38 460 4.0E-154
sp|E4USS9|CBPYA_ARTGP Carboxypeptidase Y homolog A OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=CPYA PE=3 SV=1 38 457 9.0E-154
sp|C5FWJ1|CBPYA_ARTOC Carboxypeptidase Y homolog A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CPYA PE=3 SV=1 38 457 9.0E-154
sp|C0NX46|CBPYA_AJECG Carboxypeptidase Y homolog A OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CPYA PE=3 SV=1 38 460 2.0E-153
sp|Q5J6J0|CBPYA_TRIRU Carboxypeptidase Y homolog A OS=Trichophyton rubrum GN=cpyA PE=3 SV=1 39 457 7.0E-153
sp|A6RGA0|CBPYA_AJECN Carboxypeptidase Y homolog A OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=CPYA PE=3 SV=1 38 460 8.0E-153
sp|A4RPY8|CBPYA_MAGO7 Carboxypeptidase Y homolog A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CPYA PE=3 SV=1 39 457 1.0E-152
sp|A6RUD7|CBPYA_BOTFB Carboxypeptidase Y homolog A OS=Botryotinia fuckeliana (strain B05.10) GN=CPYA PE=3 SV=1 39 454 2.0E-152
sp|C4JNM2|CBPYA_UNCRE Carboxypeptidase Y homolog A OS=Uncinocarpus reesii (strain UAMH 1704) GN=cpyA PE=3 SV=1 38 457 2.0E-152
sp|Q2H9G6|CBPYA_CHAGB Carboxypeptidase Y homolog A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CPYA PE=3 SV=1 38 460 3.0E-152
sp|Q0CSD3|CBPYA_ASPTN Carboxypeptidase Y homolog A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cpyA PE=3 SV=1 38 457 7.0E-151
sp|C5P212|CBPYA_COCP7 Carboxypeptidase Y homolog A OS=Coccidioides posadasii (strain C735) GN=cpyA PE=3 SV=1 20 457 1.0E-150
sp|A1CUJ5|CBPYA_ASPCL Carboxypeptidase Y homolog A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cpyA PE=3 SV=1 38 457 2.0E-150
sp|C1GXD8|CBPYA_PARBA Carboxypeptidase Y homolog A OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=CPYA PE=3 SV=1 39 457 2.0E-150
sp|Q5VJG9|CBPYA_ASPFU Carboxypeptidase Y homolog A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cpyA PE=3 SV=1 38 457 3.0E-150
sp|C0SGX7|CBPYA_PARBP Carboxypeptidase Y homolog A OS=Paracoccidioides brasiliensis (strain Pb03) GN=CPYA PE=3 SV=1 39 457 5.0E-150
sp|C1GG77|CBPYA_PARBD Carboxypeptidase Y homolog A OS=Paracoccidioides brasiliensis (strain Pb18) GN=CPYA PE=3 SV=1 39 457 6.0E-150
sp|A1DP75|CBPYA_NEOFI Carboxypeptidase Y homolog A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cpyA PE=3 SV=1 38 457 6.0E-150
sp|B6HPP6|CBPYA_PENRW Carboxypeptidase Y homolog A OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=cpyA PE=3 SV=1 39 457 7.0E-150
sp|E5A7I6|CBPYA_LEPMJ Carboxypeptidase Y homolog A OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=CPYA PE=3 SV=1 38 456 1.0E-149
sp|B8NXS9|CBPYA_ASPFN Carboxypeptidase Y homolog A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cpyA PE=3 SV=1 42 457 4.0E-149
sp|Q2TYA1|CBPYA_ASPOR Carboxypeptidase Y homolog A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpyA PE=3 SV=1 42 457 4.0E-149
sp|Q96VC4|CBPYA_EMENI Carboxypeptidase Y homolog A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpyA PE=3 SV=1 42 457 9.0E-149
sp|A5AB21|CBPYA_ASPNC Carboxypeptidase Y homolog A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cpyA PE=3 SV=1 38 457 1.0E-147
sp|B2WKF1|CBPYA_PYRTR Carboxypeptidase Y homolog A OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cpyA PE=3 SV=1 39 455 6.0E-145
sp|Q0V1R1|CBPYA_PHANO Carboxypeptidase Y homolog A OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CPYA PE=3 SV=1 38 456 1.0E-143
sp|P30574|CBPY_CANAX Carboxypeptidase Y OS=Candida albicans GN=CPY1 PE=2 SV=2 46 457 8.0E-142
sp|P52710|CBPY_PICPG Carboxypeptidase Y OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PRC1 PE=1 SV=1 45 457 6.0E-133
sp|P00729|CBPY_YEAST Carboxypeptidase Y OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRC1 PE=1 SV=1 34 455 3.0E-125
sp|D4ASE6|SCPF_ARTBC Carboxypeptidase Y homolog ARB_07161 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07161 PE=3 SV=2 13 457 4.0E-123
sp|P38109|YBY9_YEAST Putative serine carboxypeptidase YBR139W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR139W PE=1 SV=1 39 455 2.0E-119
sp|O13849|CBPY_SCHPO Carboxypeptidase Y OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cpy1 PE=1 SV=1 45 455 7.0E-104
sp|P52712|CBPX_ORYSJ Serine carboxypeptidase-like OS=Oryza sativa subsp. japonica GN=CBP31 PE=2 SV=2 63 455 6.0E-73
sp|P37891|CBP3_ORYSJ Serine carboxypeptidase 3 OS=Oryza sativa subsp. japonica GN=CBP3 PE=2 SV=1 25 456 3.0E-71
sp|P32826|SCP49_ARATH Serine carboxypeptidase-like 49 OS=Arabidopsis thaliana GN=SCPL49 PE=2 SV=2 48 454 6.0E-71
sp|P21529|CBP3_HORVU Serine carboxypeptidase 3 OS=Hordeum vulgare GN=CBP3 PE=1 SV=2 21 456 1.0E-69
sp|Q56WF8|SCP48_ARATH Serine carboxypeptidase-like 48 OS=Arabidopsis thaliana GN=SCPL48 PE=2 SV=2 67 456 1.0E-68
sp|P11515|CBP3_WHEAT Serine carboxypeptidase 3 OS=Triticum aestivum GN=CBP3 PE=2 SV=1 29 456 6.0E-68
sp|Q9FFB0|SCP47_ARATH Serine carboxypeptidase-like 47 OS=Arabidopsis thaliana GN=SCPL47 PE=2 SV=1 48 456 3.0E-67
sp|P34946|CPS1_PENJA Carboxypeptidase S1 OS=Penicillium janthinellum PE=1 SV=1 51 451 1.0E-61
sp|Q54DY7|SCPL1_DICDI Serine carboxypeptidase S10 family member 1 OS=Dictyostelium discoideum GN=DDB_G0291912 PE=3 SV=1 53 442 2.0E-58
sp|D4ANB6|CBPYB_ARTBC Carboxypeptidase Y homolog ARB_05721 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05721 PE=1 SV=1 53 456 7.0E-57
sp|E7R7R2|KEX1_OGAPD Pheromone-processing carboxypeptidase KEX1 OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=KEX1 PE=3 SV=1 55 450 4.0E-53
sp|P16675|PPGB_MOUSE Lysosomal protective protein OS=Mus musculus GN=Ctsa PE=1 SV=1 50 456 4.0E-51
sp|B2W340|KEX1_PYRTR Pheromone-processing carboxypeptidase kex1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=kex1 PE=3 SV=1 51 453 2.0E-48
sp|A2QPW5|KEX1_ASPNC Pheromone-processing carboxypeptidase kex1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=kex1 PE=3 SV=1 51 454 6.0E-48
sp|Q2UPI1|KEX1_ASPOR Pheromone-processing carboxypeptidase kex1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=kex1 PE=3 SV=1 51 453 1.0E-47
sp|Q0USX0|KEX1_PHANO Pheromone-processing carboxypeptidase KEX1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=KEX1 PE=3 SV=1 51 454 2.0E-47
sp|Q6CFP3|KEX1_YARLI Pheromone-processing carboxypeptidase KEX1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KEX1 PE=3 SV=1 47 450 2.0E-47
sp|Q4WTK9|KEX1_ASPFU Pheromone-processing carboxypeptidase kex1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=kex1 PE=3 SV=1 51 453 2.0E-46
sp|B0XQ16|KEX1_ASPFC Pheromone-processing carboxypeptidase kex1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=kex1 PE=3 SV=1 51 453 2.0E-46
sp|Q3MI05|PPGB_BOVIN Lysosomal protective protein OS=Bos taurus GN=CTSA PE=2 SV=1 30 454 2.0E-46
sp|A1D3I1|KEX1_NEOFI Pheromone-processing carboxypeptidase kex1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=kex1 PE=3 SV=1 51 453 4.0E-46
sp|E9CS37|KEX1_COCPS Pheromone-processing carboxypeptidase KEX1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=KEX1 PE=3 SV=1 2 453 7.0E-46
sp|C5P635|KEX1_COCP7 Pheromone-processing carboxypeptidase KEX1 OS=Coccidioides posadasii (strain C735) GN=KEX1 PE=3 SV=1 2 453 7.0E-46
sp|P10619|PPGB_HUMAN Lysosomal protective protein OS=Homo sapiens GN=CTSA PE=1 SV=2 50 456 2.0E-45
sp|Q0CCR9|KEX1_ASPTN Pheromone-processing carboxypeptidase kex1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=kex1 PE=3 SV=1 51 453 2.0E-45
sp|C5FTV7|KEX1_ARTOC Pheromone-processing carboxypeptidase KEX1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=KEX1 PE=3 SV=1 50 453 3.0E-45
sp|Q5BDJ6|KEX1_EMENI Pheromone-processing carboxypeptidase kex1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=kex1 PE=3 SV=2 51 453 4.0E-45
sp|D5G4B1|KEX1_TUBMM Pheromone-processing carboxypeptidase KEX1 OS=Tuber melanosporum (strain Mel28) GN=KEX1 PE=3 SV=1 51 454 7.0E-45
sp|C4Y8B4|KEX1_CLAL4 Pheromone-processing carboxypeptidase KEX1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=KEX1 PE=3 SV=1 49 452 2.0E-44
sp|E5R540|KEX1_LEPMJ Pheromone-processing carboxypeptidase KEX1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=KEX1 PE=3 SV=1 51 453 4.0E-44
sp|C7YRS6|KEX1_NECH7 Pheromone-processing carboxypeptidase KEX1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=KEX1 PE=3 SV=1 7 453 6.0E-44
sp|B5RUL7|KEX1_DEBHA Pheromone-processing carboxypeptidase KEX1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KEX1 PE=3 SV=1 54 460 6.0E-44
sp|A4RE47|KEX1_MAGO7 Pheromone-processing carboxypeptidase KEX1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=KEX1 PE=3 SV=2 51 453 1.0E-43
sp|B8M719|KEX1_TALSN Pheromone-processing carboxypeptidase kex1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=kex1 PE=3 SV=1 51 454 1.0E-43
sp|A1CQL5|KEX1_ASPCL Pheromone-processing carboxypeptidase kex1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=kex1 PE=3 SV=1 51 453 2.0E-43
sp|B6K7U7|KEX1_SCHJY Pheromone-processing carboxypeptidase kex1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=kex1 PE=3 SV=1 55 457 6.0E-43
sp|D1ZEM2|KEX1_SORMK Pheromone-processing carboxypeptidase KEX1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=KEX1 PE=3 SV=2 51 453 6.0E-43
sp|B6QQZ9|KEX1_TALMQ Pheromone-processing carboxypeptidase kex1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=kex1 PE=3 SV=1 51 454 6.0E-43
sp|C9S688|KEX1_VERA1 Pheromone-processing carboxypeptidase KEX1 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=KEX1 PE=3 SV=1 51 453 8.0E-43
sp|B9WJJ7|KEX1_CANDC Pheromone-processing carboxypeptidase KEX1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=KEX1 PE=3 SV=1 1 460 8.0E-43
sp|O60123|KEX1_SCHPO Pheromone-processing carboxypeptidase kex1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kex1 PE=3 SV=1 52 459 2.0E-42
sp|P52715|YUA6_CAEEL Uncharacterized serine carboxypeptidase F13S12.6 OS=Caenorhabditis elegans GN=F13D12.6 PE=3 SV=1 48 442 3.0E-42
sp|E9ESM3|KEX1_METRA Pheromone-processing carboxypeptidase KEX1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=KEX1 PE=3 SV=1 51 453 5.0E-42
sp|A8NYP0|KEX1_COPC7 Pheromone-processing carboxypeptidase KEX1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=KEX1 PE=3 SV=1 54 453 6.0E-42
sp|Q8L7B2|SCP20_ARATH Serine carboxypeptidase-like 20 OS=Arabidopsis thaliana GN=SCPL20 PE=2 SV=2 52 455 8.0E-42
sp|Q6FTM9|KEX1_CANGA Pheromone-processing carboxypeptidase KEX1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KEX1 PE=3 SV=1 52 449 2.0E-41
sp|C4QZV7|KEX1_PICPG Pheromone-processing carboxypeptidase KEX1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=KEX1 PE=3 SV=1 63 459 3.0E-41
sp|O74702|KEX1_PICPA Pheromone-processing carboxypeptidase KEX1 OS=Komagataella pastoris GN=KEX1 PE=3 SV=1 63 459 3.0E-41
sp|Q9LSV8|SCP21_ARATH Serine carboxypeptidase-like 21 OS=Arabidopsis thaliana GN=SCPL21 PE=2 SV=2 52 456 3.0E-41
sp|Q9D3S9|CPVL_MOUSE Probable serine carboxypeptidase CPVL OS=Mus musculus GN=Cpvl PE=2 SV=2 52 458 4.0E-41
sp|Q2GYB7|KEX1_CHAGB Pheromone-processing carboxypeptidase KEX1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=KEX1 PE=3 SV=1 51 453 5.0E-41
sp|B6H7A4|KEX1_PENRW Pheromone-processing carboxypeptidase kex1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=kex1 PE=3 SV=1 51 453 9.0E-41
sp|Q1K722|KEX1_NEUCR Pheromone-processing carboxypeptidase kex1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kex1 PE=3 SV=2 51 453 1.0E-40
sp|B2B762|KEX1_PODAN Pheromone-processing carboxypeptidase KEX1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=KEX1 PE=3 SV=1 66 453 3.0E-40
sp|C4YTG0|KEX1_CANAW Pheromone-processing carboxypeptidase KEX1 OS=Candida albicans (strain WO-1) GN=KEX1 PE=3 SV=1 54 460 3.0E-40
sp|Q5AFP8|KEX1_CANAL Pheromone-processing carboxypeptidase KEX1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=KEX1 PE=3 SV=1 54 460 4.0E-40
sp|C4JTD3|KEX1_UNCRE Pheromone-processing carboxypeptidase KEX1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=KEX1 PE=3 SV=1 51 453 4.0E-40
sp|C5GC75|KEX1_AJEDR Pheromone-processing carboxypeptidase KEX1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=KEX1 PE=3 SV=1 51 453 8.0E-40
sp|Q54VW1|SCPL2_DICDI Serine carboxypeptidase S10 family member 2 OS=Dictyostelium discoideum GN=DDB_G0280105 PE=3 SV=1 51 453 9.0E-40
sp|C5JN54|KEX1_AJEDS Pheromone-processing carboxypeptidase KEX1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=KEX1 PE=3 SV=1 51 453 9.0E-40
sp|Q4QR71|CPVL_RAT Probable serine carboxypeptidase CPVL OS=Rattus norvegicus GN=CPVL PE=2 SV=1 52 458 1.0E-39
sp|Q9H3G5|CPVL_HUMAN Probable serine carboxypeptidase CPVL OS=Homo sapiens GN=CPVL PE=1 SV=2 51 458 1.0E-39
sp|E9E1Z2|KEX1_METAQ Pheromone-processing carboxypeptidase KEX1 OS=Metarhizium acridum (strain CQMa 102) GN=KEX1 PE=3 SV=1 51 453 1.0E-39
sp|Q4P8U8|KEX1_USTMA Pheromone-processing carboxypeptidase KEX1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=KEX1 PE=3 SV=1 62 453 2.0E-39
sp|C5MFP8|KEX1_CANTT Pheromone-processing carboxypeptidase KEX1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=KEX1 PE=3 SV=1 31 460 5.0E-39
sp|C1G2I2|KEX1_PARBD Pheromone-processing carboxypeptidase KEX1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=KEX1 PE=3 SV=1 66 453 7.0E-39
sp|C0SGJ2|KEX1_PARBP Pheromone-processing carboxypeptidase KEX1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=KEX1 PE=3 SV=1 66 453 8.0E-39
sp|A5DAT0|KEX1_PICGU Pheromone-processing carboxypeptidase KEX1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=KEX1 PE=3 SV=2 54 450 8.0E-39
sp|Q5RFE4|CPVL_PONAB Probable serine carboxypeptidase CPVL OS=Pongo abelii GN=CPVL PE=2 SV=1 46 458 9.0E-39
sp|A7EYY7|KEX1_SCLS1 Pheromone-processing carboxypeptidase kex1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=kex1 PE=3 SV=1 66 453 1.0E-38
sp|P07519|CBP1_HORVU Serine carboxypeptidase 1 OS=Hordeum vulgare GN=CBP1 PE=1 SV=4 52 455 2.0E-38
sp|E3L8A5|KEX1_PUCGT Pheromone-processing carboxypeptidase KEX1 OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=KEX1 PE=3 SV=2 60 453 4.0E-38
sp|C1GP85|KEX1_PARBA Pheromone-processing carboxypeptidase KEX1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=KEX1 PE=3 SV=1 66 453 4.0E-38
sp|Q9MAR8|SCP44_ARATH Serine carboxypeptidase-like 44 OS=Arabidopsis thaliana GN=SCPL44 PE=2 SV=1 52 456 6.0E-38
sp|Q9C7D6|SCP17_ARATH Serine carboxypeptidase-like 17 OS=Arabidopsis thaliana GN=SCPL17 PE=2 SV=1 55 456 8.0E-38
sp|Q9CAU1|SCP3_ARATH Serine carboxypeptidase-like 3 OS=Arabidopsis thaliana GN=SCPL3 PE=2 SV=1 55 456 2.0E-37
sp|P37890|CBP1_ORYSJ Serine carboxypeptidase 1 OS=Oryza sativa subsp. japonica GN=CBP1 PE=2 SV=1 52 455 2.0E-37
sp|C5DT72|KEX1_ZYGRC Pheromone-processing carboxypeptidase KEX1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=KEX1 PE=3 SV=1 1 449 4.0E-37
sp|C9WMM5|VCP_APIME Venom serine carboxypeptidase OS=Apis mellifera PE=2 SV=1 48 452 7.0E-37
sp|P42661|NF314_NAEFO Virulence-related protein Nf314 OS=Naegleria fowleri PE=2 SV=1 51 455 7.0E-37
sp|Q09991|YSS2_CAEEL Uncharacterized serine carboxypeptidase K10B2.2 OS=Caenorhabditis elegans GN=K10B2.2 PE=3 SV=1 53 443 8.0E-37
sp|Q6CKK4|KEX1_KLULA Pheromone-processing carboxypeptidase KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=1 64 451 1.0E-36
sp|E3QDT3|KEX1_COLGM Pheromone-processing carboxypeptidase KEX1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=KEX1 PE=3 SV=1 51 454 2.0E-36
sp|P42660|VCP_AEDAE Vitellogenic carboxypeptidase OS=Aedes aegypti GN=VCP PE=1 SV=3 48 452 2.0E-36
sp|D0MVS1|KEX1_PHYIT Pheromone-processing carboxypeptidase KEX1 OS=Phytophthora infestans (strain T30-4) GN=KEX1 PE=3 SV=1 9 454 3.0E-36
sp|A6QX86|KEX1_AJECN Pheromone-processing carboxypeptidase KEX1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=KEX1 PE=3 SV=1 51 453 3.0E-36
sp|A7TLB3|KEX1_VANPO Pheromone-processing carboxypeptidase KEX1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=KEX1 PE=3 SV=1 60 449 3.0E-36
sp|Q9C7D4|SCP16_ARATH Serine carboxypeptidase-like 16 OS=Arabidopsis thaliana GN=SCPL16 PE=2 SV=1 32 456 5.0E-36
sp|Q9M9Q6|SCP50_ARATH Serine carboxypeptidase-like 50 OS=Arabidopsis thaliana GN=SCPL50 PE=2 SV=1 55 456 5.0E-36
sp|O81009|SCP12_ARATH Serine carboxypeptidase-like 12 OS=Arabidopsis thaliana GN=SCPL12 PE=2 SV=1 55 456 1.0E-35
sp|Q9CAU0|SCP6_ARATH Serine carboxypeptidase-like 6 OS=Arabidopsis thaliana GN=SCPL6 PE=2 SV=2 55 456 1.0E-35
sp|Q9CAU3|SCP2_ARATH Serine carboxypeptidase-like 2 OS=Arabidopsis thaliana GN=SCPL2 PE=2 SV=1 55 456 2.0E-35
sp|A5E751|KEX1_LODEL Pheromone-processing carboxypeptidase KEX1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=KEX1 PE=3 SV=1 62 443 2.0E-35
sp|Q9LSM9|SCP33_ARATH Serine carboxypeptidase-like 33 OS=Arabidopsis thaliana GN=SCPL33 PE=2 SV=2 51 456 2.0E-35
sp|Q9ZQQ0|SCP26_ARATH Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana GN=SCPL26 PE=2 SV=1 53 456 2.0E-35
sp|Q41005|CBPX_PEA Serine carboxypeptidase-like (Fragment) OS=Pisum sativum PE=2 SV=1 178 455 2.0E-35
sp|Q9SV02|SCP39_ARATH Serine carboxypeptidase-like 39 OS=Arabidopsis thaliana GN=SCPL39 PE=2 SV=1 25 453 4.0E-35
sp|Q9FH06|SCP41_ARATH Serine carboxypeptidase-like 41 OS=Arabidopsis thaliana GN=SCPL41 PE=2 SV=1 52 456 4.0E-35
sp|P52711|CBP23_HORVU Serine carboxypeptidase II-3 OS=Hordeum vulgare GN=CXP;2-3 PE=2 SV=1 33 456 4.0E-35
sp|Q8RWJ6|SCP1_ARATH Serine carboxypeptidase-like 1 OS=Arabidopsis thaliana GN=SCPL1 PE=2 SV=1 55 456 5.0E-35
sp|P55748|CBP22_HORVU Serine carboxypeptidase II-2 (Fragment) OS=Hordeum vulgare GN=CXP;2-2 PE=1 SV=1 53 456 5.0E-35
sp|C8Z852|KEX1_YEAS8 Pheromone-processing carboxypeptidase KEX1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=KEX1 PE=3 SV=1 61 451 6.0E-35
sp|E7NHF8|KEX1_YEASO Pheromone-processing carboxypeptidase KEX1 OS=Saccharomyces cerevisiae (strain FostersO) GN=KEX1 PE=3 SV=1 61 451 7.0E-35
sp|C7GWZ2|KEX1_YEAS2 Pheromone-processing carboxypeptidase KEX1 OS=Saccharomyces cerevisiae (strain JAY291) GN=KEX1 PE=3 SV=1 61 451 7.0E-35
sp|P09620|KEX1_YEAST Pheromone-processing carboxypeptidase KEX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX1 PE=1 SV=1 61 451 8.0E-35
sp|P52717|YUW5_CAEEL Uncharacterized serine carboxypeptidase F41C3.5 OS=Caenorhabditis elegans GN=F41C3.5 PE=1 SV=1 52 437 2.0E-34
sp|Q9CAU2|SCP5_ARATH Serine carboxypeptidase-like 5 OS=Arabidopsis thaliana GN=SCPL5 PE=2 SV=2 55 456 2.0E-34
sp|E6R6G5|KEX1_CRYGW Pheromone-processing carboxypeptidase KEX1 OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=KEX1 PE=3 SV=1 64 454 3.0E-34
sp|Q8VZU3|SCP19_ARATH Serine carboxypeptidase-like 19 OS=Arabidopsis thaliana GN=SCPL19 PE=1 SV=1 55 456 3.0E-34
sp|D4B5L8|KEX1_ARTBC Pheromone-processing carboxypeptidase KEX1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=KEX1 PE=3 SV=1 95 453 5.0E-34
sp|Q4PSY2|SCP32_ARATH Serine carboxypeptidase-like 32 OS=Arabidopsis thaliana GN=SCPL32 PE=2 SV=1 50 455 8.0E-34
sp|Q9SQX6|SCP7_ARATH Serine carboxypeptidase-like 7 OS=Arabidopsis thaliana GN=SCPL7 PE=2 SV=1 55 456 1.0E-33
sp|O82229|SCP23_ARATH Putative serine carboxypeptidase-like 23 OS=Arabidopsis thaliana GN=SCPL23 PE=2 SV=2 53 456 2.0E-33
sp|C5DLM9|KEX1_LACTC Pheromone-processing carboxypeptidase KEX1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=KEX1 PE=3 SV=1 60 449 2.0E-33
sp|Q2V465|SCP11_ARATH Serine carboxypeptidase-like 11 OS=Arabidopsis thaliana GN=SCPL11 PE=2 SV=2 55 456 3.0E-33
sp|C5FGX1|SCPB_ARTOC Carboxypeptidase S1 homolog B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SCPB PE=3 SV=1 68 451 4.0E-33
sp|Q9CAU4|SCP4_ARATH Serine carboxypeptidase-like 4 OS=Arabidopsis thaliana GN=SCPL4 PE=2 SV=1 55 456 4.0E-33
sp|O04084|SCP31_ARATH Serine carboxypeptidase-like 31 OS=Arabidopsis thaliana GN=SCPL31 PE=2 SV=2 50 455 6.0E-33
sp|Q0WPR4|SCP34_ARATH Serine carboxypeptidase-like 34 OS=Arabidopsis thaliana GN=SCPL34 PE=2 SV=2 15 214 2.0E-32
sp|Q869Q8|CPVL_DICDI Probable serine carboxypeptidase CPVL OS=Dictyostelium discoideum GN=cpvl PE=3 SV=1 7 456 3.0E-32
sp|Q8H780|SCP13_ARATH Serine carboxypeptidase-like 13 OS=Arabidopsis thaliana GN=SCPL13 PE=2 SV=2 55 456 3.0E-32
sp|Q84WF0|SCP37_ARATH Serine carboxypeptidase-like 37 OS=Arabidopsis thaliana GN=SCPL37 PE=2 SV=2 33 453 6.0E-32
sp|D4AQ54|SCPC_ARTBC Carboxypeptidase Y homolog ARB_06361 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06361 PE=1 SV=1 1 453 7.0E-32
sp|Q9LEY1|SCP35_ARATH Serine carboxypeptidase-like 35 OS=Arabidopsis thaliana GN=SCPL35 PE=2 SV=1 3 214 8.0E-32
sp|Q752M5|KEX1_ASHGO Pheromone-processing carboxypeptidase KEX1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KEX1 PE=3 SV=1 58 448 9.0E-32
sp|Q5J6J2|SCPB_TRIRU Carboxypeptidase S1 homolog B OS=Trichophyton rubrum GN=SCPB PE=1 SV=1 50 451 1.0E-31
sp|D4AIF1|SCPA_ARTBC Carboxypeptidase S1 homolog A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SCPA PE=3 SV=1 51 453 1.0E-31
sp|D4DD24|SCPA_TRIVH Carboxypeptidase S1 homolog A OS=Trichophyton verrucosum (strain HKI 0517) GN=SCPA PE=3 SV=1 51 453 1.0E-31
sp|Q949Q7|SCP29_ARATH Serine carboxypeptidase-like 29 OS=Arabidopsis thaliana GN=SCPL29 PE=2 SV=1 53 455 1.0E-31
sp|Q9C7D3|SCP14_ARATH Serine carboxypeptidase-like 14 OS=Arabidopsis thaliana GN=SCPL14 PE=2 SV=1 32 456 1.0E-31
sp|Q9C7D2|SCP15_ARATH Serine carboxypeptidase-like 15 OS=Arabidopsis thaliana GN=SCPL15 PE=2 SV=2 55 456 2.0E-31
sp|O64811|SCP9_ARATH Serine carboxypeptidase-like 9 OS=Arabidopsis thaliana GN=SCPL9 PE=2 SV=1 55 456 2.0E-31
sp|Q9SFB5|SCP27_ARATH Serine carboxypeptidase-like 27 OS=Arabidopsis thaliana GN=SCPL27 PE=2 SV=1 52 456 3.0E-31
sp|Q84W27|SCP43_ARATH Serine carboxypeptidase-like 43 OS=Arabidopsis thaliana GN=SCPL43 PE=2 SV=1 52 456 5.0E-31
sp|Q9SV04|SCP36_ARATH Serine carboxypeptidase-like 36 OS=Arabidopsis thaliana GN=SCPL36 PE=2 SV=1 50 218 6.0E-31
sp|Q8L9Y0|SCP25_ARATH Serine carboxypeptidase-like 25 OS=Arabidopsis thaliana GN=SCPL25 PE=2 SV=2 33 456 6.0E-31
sp|Q9FH05|SCP42_ARATH Serine carboxypeptidase-like 42 OS=Arabidopsis thaliana GN=SCPL42 PE=2 SV=1 52 456 2.0E-30
sp|Q9LXY6|SCP53_ARATH Putative serine carboxypeptidase-like 53 OS=Arabidopsis thaliana GN=SCPL53 PE=5 SV=1 52 186 3.0E-30
sp|O64810|SCP10_ARATH Serine carboxypeptidase-like 10 OS=Arabidopsis thaliana GN=SCPL10 PE=2 SV=1 55 456 4.0E-30
sp|Q9M099|SCP24_ARATH Serine carboxypeptidase 24 OS=Arabidopsis thaliana GN=SCPL24 PE=1 SV=1 53 456 4.0E-30
sp|Q93Y09|SCP45_ARATH Serine carboxypeptidase-like 45 OS=Arabidopsis thaliana GN=SCPL45 PE=2 SV=1 52 456 5.0E-30
sp|Q5J6J1|SPCA_TRIRU Carboxypeptidase S1 homolog A OS=Trichophyton rubrum GN=SCPA PE=1 SV=1 51 453 6.0E-30
sp|Q0WRX3|SCP40_ARATH Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana GN=SCPL40 PE=2 SV=2 53 214 9.0E-30
sp|Q8S8K6|SCP28_ARATH Serine carboxypeptidase-like 28 OS=Arabidopsis thaliana GN=SCPL28 PE=2 SV=2 53 453 1.0E-29
sp|Q8RUW5|SCP8_ARATH Serine carboxypeptidase-like 8 OS=Arabidopsis thaliana GN=SCPL8 PE=1 SV=2 55 456 2.0E-29
sp|B6V867|SCPA_TRITO Carboxypeptidase S1 homolog A OS=Trichophyton tonsurans GN=SCPA PE=3 SV=1 51 453 2.0E-29
sp|Q9C7Z9|SCP18_ARATH Serine carboxypeptidase-like 18 OS=Arabidopsis thaliana GN=SCPL18 PE=2 SV=2 55 456 2.0E-29
sp|A7UKV5|SPCA_TRIEQ Carboxypeptidase S1 homolog A OS=Trichophyton equinum GN=SCPA PE=3 SV=1 51 453 2.0E-29
sp|Q8VY01|SCP46_ARATH Serine carboxypeptidase-like 46 OS=Arabidopsis thaliana GN=SCPL46 PE=2 SV=1 52 456 2.0E-29
sp|P08819|CBP2_WHEAT Serine carboxypeptidase 2 OS=Triticum aestivum GN=CBP2 PE=1 SV=2 53 214 5.0E-29
sp|P52719|PEPS_ASPPH Carboxypeptidase cpdS OS=Aspergillus phoenicis GN=cpdS PE=1 SV=1 49 435 1.0E-28
sp|O23364|SCP30_ARATH Putative serine carboxypeptidase-like 30 OS=Arabidopsis thaliana GN=SCPL30 PE=2 SV=2 50 455 8.0E-28
sp|C5FW30|SPCA_ARTOC Carboxypeptidase S1 homolog A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SCPA PE=3 SV=1 51 453 2.0E-27
sp|Q9ZUG3|SCP38_ARATH Serine carboxypeptidase-like 38 OS=Arabidopsis thaliana GN=SCPL38 PE=2 SV=1 50 374 5.0E-27
sp|P08818|CBP2_HORVU Serine carboxypeptidase 2 OS=Hordeum vulgare GN=CBP2 PE=1 SV=2 53 214 6.0E-27
sp|D4AP52|SCPB_ARTBC Carboxypeptidase S1 homolog B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SCPB PE=3 SV=1 50 451 9.0E-27
sp|P32825|SXA2_SCHPO Carboxypeptidase sxa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sxa2 PE=2 SV=1 54 220 2.0E-26
sp|Q1PF08|SCP22_ARATH Serine carboxypeptidase-like 22 OS=Arabidopsis thaliana GN=SCPL22 PE=2 SV=1 53 214 5.0E-26
sp|P52714|YXD2_CAEEL Uncharacterized serine carboxypeptidase C08H9.1 OS=Caenorhabditis elegans GN=C08H9.1 PE=1 SV=1 55 456 1.0E-24
sp|P52716|YPP3_CAEEL Uncharacterized serine carboxypeptidase F32A5.3 OS=Caenorhabditis elegans GN=F32A5.3 PE=1 SV=1 52 381 8.0E-24
sp|P52708|HNLS_SORBI P-(S)-hydroxymandelonitrile lyase OS=Sorghum bicolor PE=1 SV=2 54 456 6.0E-23
sp|Q920A5|RISC_MOUSE Retinoid-inducible serine carboxypeptidase OS=Mus musculus GN=Scpep1 PE=1 SV=2 62 443 1.0E-21
sp|Q920A6|RISC_RAT Retinoid-inducible serine carboxypeptidase OS=Rattus norvegicus GN=Scpep1 PE=2 SV=1 62 441 4.0E-21
sp|D4AZG9|SCPE_ARTBC Carboxypeptidase Y homolog ARB_06361 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01587 PE=3 SV=1 7 211 1.0E-20
sp|D4B0Q6|SCPD_ARTBC Carboxypeptidase Y homolog ARB_02032 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02032 PE=3 SV=2 67 208 2.0E-20
sp|D4AQA7|PEPS_ARTBC Probable serine carboxypeptidase ARB_06414 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06414 PE=1 SV=1 65 449 3.0E-20
sp|Q9HB40|RISC_HUMAN Retinoid-inducible serine carboxypeptidase OS=Homo sapiens GN=SCPEP1 PE=1 SV=1 62 441 2.0E-19
sp|P52718|PEPF_ASPNG Serine-type carboxypeptidase F OS=Aspergillus niger GN=pepF PE=1 SV=3 49 459 6.0E-19
sp|Q9FFB2|SCP54_ARATH Putative serine carboxypeptidase-like 54 OS=Arabidopsis thaliana GN=SCPL54 PE=5 SV=1 48 193 8.0E-19
sp|Q67Y83|SCP51_ARATH Serine carboxypeptidase-like 51 OS=Arabidopsis thaliana GN=SCPL51 PE=2 SV=2 66 442 9.0E-18
sp|P55747|CBP21_HORVU Serine carboxypeptidase II-1 (Fragment) OS=Hordeum vulgare GN=CXP;2-1 PE=1 SV=1 152 453 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0004185 serine-type carboxypeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0004180 carboxypeptidase activity No
GO:0017171 serine hydrolase activity No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0008236 serine-type peptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0008238 exopeptidase activity No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0008233 peptidase activity No
GO:0071704 organic substance metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0070008 serine-type exopeptidase activity No
GO:0019538 protein metabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2360
MRFLLPALVLAASVGSVASEKVRSNTSAVEPAKQADSTRTFDTLALGVDTVRQFSGYLDDEKNDKHLFYWFFESR
GDAAKDPVILWVEGGPGCSSMLGLFQQVGPANIKKNLTVASNPLSWTNRASIIFLDQPANTGFSHTSKRVTSTAA
GAKDVVAAMRLFFKKFPEYAKQDFYIAGTSYSGHHVPVFAAEILSQPDSDINLKGAIIGNGLTDAKVQFQSYRPM
ACGEGGIPAVINETTCQAMQAAEPKCQEMMQACYDTEEDAACLEANSFCEKNIAGRPAADGINIYNLRKECIGNF
DNFCTTSVEPIDRFLNQAKTQKALGVEDVDRWEVCSSDSGTDIRSSGDGAKPHQRDVTKALEKIPVLVFAGDGDY
ICNWLGNRDWTNALDWPGHHAFDKAEVEPLNISSGEKQSQYGEIKSASGLTFARIFNAGHFAIEDQPEGLFDLFS
RWMDGEWDSK
Coding >Ophio5|2360
ATGAGGTTTCTCCTTCCAGCTCTGGTATTAGCAGCATCCGTTGGTTCAGTCGCGTCAGAAAAGGTGCGCAGCAAC
ACGTCTGCTGTCGAACCGGCCAAGCAGGCCGACTCAACCCGGACTTTTGACACTTTGGCGCTGGGCGTCGATACT
GTCAGGCAATTCAGTGGCTACCTTGACGATGAGAAGAACGATAAGCACCTGTTCTACTGGTTCTTTGAGTCACGC
GGAGATGCAGCCAAGGACCCTGTGATACTATGGGTTGAGGGGGGTCCTGGATGTTCCTCTATGCTCGGACTCTTC
CAGCAGGTGGGACCGGCCAACATCAAGAAAAATCTCACGGTTGCTTCGAATCCTCTCTCTTGGACCAACCGAGCC
TCCATCATCTTCCTCGATCAGCCCGCCAACACAGGTTTCTCACACACCAGTAAGCGCGTTACCAGCACCGCCGCT
GGAGCCAAAGATGTCGTTGCCGCCATGAGGCTCTTCTTTAAAAAGTTCCCCGAGTACGCCAAGCAAGACTTTTAC
ATCGCGGGAACCTCATACTCCGGTCACCACGTGCCGGTCTTTGCCGCTGAGATACTGTCACAGCCGGACAGCGAT
ATCAACCTCAAGGGCGCCATCATTGGGAACGGTCTGACAGATGCTAAAGTTCAGTTTCAGTCCTACCGGCCTATG
GCCTGCGGCGAGGGAGGCATCCCAGCCGTCATCAACGAGACAACTTGCCAGGCCATGCAGGCTGCGGAGCCGAAA
TGTCAGGAGATGATGCAGGCCTGCTACGACACCGAAGAGGATGCAGCTTGCCTGGAAGCGAATTCTTTCTGCGAG
AAAAACATTGCTGGACGCCCGGCAGCGGATGGCATCAACATATACAATCTACGTAAGGAATGCATCGGTAACTTT
GACAACTTTTGCACCACCAGTGTCGAGCCCATTGACCGCTTCCTCAACCAGGCAAAGACCCAGAAAGCCCTCGGG
GTCGAGGACGTCGACCGCTGGGAAGTGTGCAGCAGTGACAGCGGCACAGACATTAGAAGTTCAGGTGACGGGGCA
AAGCCACATCAACGGGACGTGACCAAGGCTCTGGAAAAGATTCCTGTGCTCGTCTTTGCCGGTGACGGGGATTAC
ATATGCAACTGGCTCGGCAATCGAGACTGGACTAATGCTCTCGACTGGCCCGGTCACCATGCCTTTGATAAGGCT
GAGGTTGAGCCACTGAACATCTCTTCCGGCGAGAAACAGAGTCAATACGGCGAGATCAAGTCCGCGAGCGGGCTG
ACCTTTGCCCGAATATTTAATGCTGGTCATTTTGCTATCGAAGATCAGCCTGAGGGCTTGTTCGACCTCTTTAGT
CGATGGATGGATGGGGAATGGGACTCAAAG
Transcript >Ophio5|2360
ATGAGGTTTCTCCTTCCAGCTCTGGTATTAGCAGCATCCGTTGGTTCAGTCGCGTCAGAAAAGGTGCGCAGCAAC
ACGTCTGCTGTCGAACCGGCCAAGCAGGCCGACTCAACCCGGACTTTTGACACTTTGGCGCTGGGCGTCGATACT
GTCAGGCAATTCAGTGGCTACCTTGACGATGAGAAGAACGATAAGCACCTGTTCTACTGGTTCTTTGAGTCACGC
GGAGATGCAGCCAAGGACCCTGTGATACTATGGGTTGAGGGGGGTCCTGGATGTTCCTCTATGCTCGGACTCTTC
CAGCAGGTGGGACCGGCCAACATCAAGAAAAATCTCACGGTTGCTTCGAATCCTCTCTCTTGGACCAACCGAGCC
TCCATCATCTTCCTCGATCAGCCCGCCAACACAGGTTTCTCACACACCAGTAAGCGCGTTACCAGCACCGCCGCT
GGAGCCAAAGATGTCGTTGCCGCCATGAGGCTCTTCTTTAAAAAGTTCCCCGAGTACGCCAAGCAAGACTTTTAC
ATCGCGGGAACCTCATACTCCGGTCACCACGTGCCGGTCTTTGCCGCTGAGATACTGTCACAGCCGGACAGCGAT
ATCAACCTCAAGGGCGCCATCATTGGGAACGGTCTGACAGATGCTAAAGTTCAGTTTCAGTCCTACCGGCCTATG
GCCTGCGGCGAGGGAGGCATCCCAGCCGTCATCAACGAGACAACTTGCCAGGCCATGCAGGCTGCGGAGCCGAAA
TGTCAGGAGATGATGCAGGCCTGCTACGACACCGAAGAGGATGCAGCTTGCCTGGAAGCGAATTCTTTCTGCGAG
AAAAACATTGCTGGACGCCCGGCAGCGGATGGCATCAACATATACAATCTACGTAAGGAATGCATCGGTAACTTT
GACAACTTTTGCACCACCAGTGTCGAGCCCATTGACCGCTTCCTCAACCAGGCAAAGACCCAGAAAGCCCTCGGG
GTCGAGGACGTCGACCGCTGGGAAGTGTGCAGCAGTGACAGCGGCACAGACATTAGAAGTTCAGGTGACGGGGCA
AAGCCACATCAACGGGACGTGACCAAGGCTCTGGAAAAGATTCCTGTGCTCGTCTTTGCCGGTGACGGGGATTAC
ATATGCAACTGGCTCGGCAATCGAGACTGGACTAATGCTCTCGACTGGCCCGGTCACCATGCCTTTGATAAGGCT
GAGGTTGAGCCACTGAACATCTCTTCCGGCGAGAAACAGAGTCAATACGGCGAGATCAAGTCCGCGAGCGGGCTG
ACCTTTGCCCGAATATTTAATGCTGGTCATTTTGCTATCGAAGATCAGCCTGAGGGCTTGTTCGACCTCTTTAGT
CGATGGATGGATGGGGAATGGGACTCAAAGTGA
Gene >Ophio5|2360
ATGAGGTTTCTCCTTCCAGCTCTGGTATTAGCAGCATCCGTTGGTTCAGTCGCGTCAGAAAAGGTGCGCAGCAAC
ACGTCTGCTGTCGAACCGGCCAAGCAGGCCGACTCAACCCGGACTTTTGACACTTTGGCGCTGGGCGTCGATACT
GTCAGGCAATTCAGTGGCTACCTTGACGATGAGAAGAACGATAAGCACCTGTTCTACTGTGACTGACGCTGCTCC
CGCTGTCCTCAACAGGAAATCGATCTGACTTTTGCAAACAGGGTTCTTTGAGTCACGCGGAGATGCAGCCAAGGA
CCCTGTGATACTATGGGTTGAGGGGGGTCCTGGATGTTCCTCTATGCTCGGACTCTTCCAGCAGGTGGGACCGGC
CAACATCAAGAAAAATCTCACGGTTGCTTCGAATCCTCTCTCTTGGACCAACCGAGCCTCCATCATCTTCCTCGA
TCAGCCCGCCAACACAGGTTTCTCACACACCAGTAAGCGCGTTACCAGCACCGCCGCTGGAGCCAAAGATGTCGT
TGCCGCCATGAGGCTCTTCTTTAAAAAGTTCCCCGAGTACGCCAAGCAAGACTTTTACATCGCGGGAACCTCATA
CTCCGGTCACCACGTGCCGGTCTTTGCCGCTGAGATACTGTCACAGCCGGACAGCGATATCAACCTCAAGGGCGC
CATCATTGGGAACGGTCTGACAGATGCTAAAGTTCAGTTTCAGTCCTACCGGCCTATGGCCTGCGGCGAGGGAGG
CATCCCAGCCGTCATCAACGAGACAACTTGCCAGGCCATGCAGGCTGCGGAGCCGAAATGTCAGGAGATGATGCA
GGCCTGCTACGACACCGAAGAGGATGCAGCTTGCCTGGAAGCGAATTCTTTCTGCGAGAAAAACATTGCTGGACG
CCCGGCAGCGGATGGCATCAACATATACAATCTACGTAAGGAATGCATCGGTAACTTTGACAACTTTTGCACCAC
CAGTGTCGAGCCCATTGACCGCTTCCTCAACCAGGCAAAGACCCAGAAAGCCCTCGGGGTCGAGGACGTCGACCG
CTGGGAAGTGTGCAGCAGTGACAGCGGCACAGACATTAGAAGTTCAGGTGACGGGGCAAAGCCACATCAACGGGA
CGTGACCAAGGCTCTGGAAAAGATTCCTGTGCTCGTCTTTGCCGGTGACGGGGATTACATATGCAACTGGCTCGG
CAATCGAGACTGGACTAATGCTCTCGACTGGCCCGGTCACCATGCCTTTGATAAGGCTGAGGTTGAGCCACTGAA
CATCTCTTCCGGCGAGAAACAGAGTCAATACGGCGAGATCAAGTCCGCGAGCGGGCTGACCTTTGCCCGAATATT
TAATGCTGGTCATTTTGCTATCGAAGATCAGCCTGAGGGCTTGTTCGACCTCTTTAGTCGATGGATGGATGGGGA
ATGGGACTCAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail