Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2353
Gene name
Locationscaffold_2:59518..61848
Strand+
Gene length (bp)2330
Transcript length (bp)2259
Coding sequence length (bp)2256
Protein length (aa) 752

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 2.6E-84 351 733

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 89 732 3.0E-165
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 189 737 2.0E-140
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 185 733 2.0E-124
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 347 699 2.0E-33
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 298 733 3.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10074|AVT3_SCHPO Vacuolar amino acid transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avt3 PE=1 SV=1 89 732 3.0E-165
sp|P36062|AVT3_YEAST Vacuolar amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT3 PE=1 SV=1 189 737 2.0E-140
sp|P50944|AVT4_YEAST Vacuolar amino acid transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT4 PE=1 SV=1 185 733 2.0E-124
sp|Q7Z2H8|S36A1_HUMAN Proton-coupled amino acid transporter 1 OS=Homo sapiens GN=SLC36A1 PE=1 SV=1 347 699 2.0E-33
sp|Q4KL91|S36A4_XENLA Proton-coupled amino acid transporter 4 OS=Xenopus laevis GN=slc36a4 PE=2 SV=1 298 733 3.0E-30
sp|Q495N2|S36A3_HUMAN Proton-coupled amino acid transporter 3 OS=Homo sapiens GN=SLC36A3 PE=2 SV=2 344 727 3.0E-30
sp|Q6YBV0|S36A4_HUMAN Proton-coupled amino acid transporter 4 OS=Homo sapiens GN=SLC36A4 PE=1 SV=1 295 729 9.0E-29
sp|Q4V8B1|S36A3_RAT Proton-coupled amino acid transporter 3 OS=Rattus norvegicus GN=Slc36a3 PE=2 SV=1 343 727 2.0E-27
sp|Q924A5|S36A1_RAT Proton-coupled amino acid transporter 1 OS=Rattus norvegicus GN=Slc36a1 PE=2 SV=1 350 699 2.0E-27
sp|Q811P0|S36A3_MOUSE Proton-coupled amino acid transporter 3 OS=Mus musculus GN=Slc36a3 PE=2 SV=1 342 729 4.0E-27
sp|Q8CH36|S36A4_MOUSE Proton-coupled amino acid transporter 4 OS=Mus musculus GN=Slc36a4 PE=2 SV=1 295 729 8.0E-27
sp|Q8K4D3|S36A1_MOUSE Proton-coupled amino acid transporter 1 OS=Mus musculus GN=Slc36a1 PE=2 SV=1 350 699 2.0E-26
sp|Q9SVG0|ANTL2_ARATH Amino acid transporter ANTL2 OS=Arabidopsis thaliana GN=At4g38250 PE=1 SV=1 350 710 2.0E-25
sp|Q495M3|S36A2_HUMAN Proton-coupled amino acid transporter 2 OS=Homo sapiens GN=SLC36A2 PE=1 SV=1 356 700 2.0E-25
sp|F4ILY9|ANTL1_ARATH Amino acid transporter ANTL1 OS=Arabidopsis thaliana GN=At2g42005 PE=2 SV=1 334 711 6.0E-25
sp|Q8BHK3|S36A2_MOUSE Proton-coupled amino acid transporter 2 OS=Mus musculus GN=Slc36a2 PE=1 SV=1 361 635 2.0E-24
sp|Q8K415|S36A2_RAT Proton-coupled amino acid transporter 2 OS=Rattus norvegicus GN=Slc36a2 PE=1 SV=1 344 635 1.0E-23
sp|Q9FKY3|ANTL3_ARATH Amino acid transporter ANTL3 OS=Arabidopsis thaliana GN=At5g65990 PE=2 SV=1 364 721 2.0E-20
sp|Q9SF09|ANT1_ARATH Amino acid transporter ANT1 OS=Arabidopsis thaliana GN=ANT1 PE=1 SV=1 348 734 7.0E-20
sp|Q503G8|S38A6_DANRE Probable sodium-coupled neutral amino acid transporter 6 OS=Danio rerio GN=slc38a6 PE=2 SV=1 305 738 4.0E-10
sp|P34479|SKAT1_CAEEL Probable amino acid transporter skat-1 OS=Caenorhabditis elegans GN=skat-1 PE=2 SV=2 307 711 3.0E-09
sp|P34579|UNC47_CAEEL Vesicular GABA transporter OS=Caenorhabditis elegans GN=unc-47 PE=1 SV=2 313 700 5.0E-06
sp|P39981|AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVT2 PE=2 SV=1 312 738 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 382 404 22
2 425 447 22
3 467 486 19
4 493 515 22
5 535 554 19
6 567 589 22
7 613 635 22
8 656 673 17
9 679 701 22
10 714 736 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2353
MSSPKNPNPSLGPLPSPAPGHSRSFSSSIPRGETTARLAGPIRSGQRSGSPAPGQQLPEGDSPLVGGRPFSQGPG
VSALAAALSDSYGQSPPRYGTPPARVTSSPPRPTSPGLPLRTDTPTNYGSFDSRSRMGQSGAAGPYEDPEIIKRH
LVQPGESENLPSEESSTQGPVRGKQSAEPGTGLNDDEFSSLRLQGGDITRGIYKWTEQAEAKGRLHRSRSFHHQR
PEPETDVLDINSIKVPGGFRRNHLRRNAMSPNRQAEADESGVESPPGTQPRLFTSSFLEFLTIYGHFAGEELEED
DEALGPNEEFWSDRAGPGDGSDDEREPMEDSALLTHSKRMRRRKPRGGSGKNSPLNAALLLLKSFVGTGVLFLPR
AYLSGGMLLSNLVLLCLAGLSYYSFVLLVSTRIRVEGSFGDMGGILYGKWMRTLILASIVISQIGFTAAYTVFTA
ENLQAFIRAVSDCRTTISIPLLILMQTLIFLPFSLLRDIGKLGFTALIADAFILIGLAYLFYYDVLTLSKFGLAD
IIMFNDKDWTLFIGTAIFTFEGIGLVIPIQESMKHPQKFPRVLFYVMIIITVVFITMGAISYAAYGSKTETVVLL
NLPQDNKLVNGVQLLYSIAILLSTPLQIFPAVRIVETELFTRSGKYNPYIKWQKNIFRFFVVMLCAAISWGGADN
LDKFVALVGNFACIPLVYIYPPLLHYKAVARNRAWKVADVVLCVFGFFAMAYATSLTIMSWANAGAKPPGYCERR
NP
Coding >Ophio5|2353
ATGTCGTCGCCCAAGAACCCAAACCCTTCCCTCGGGCCGTTGCCGTCTCCAGCCCCGGGCCATTCGCGATCGTTT
TCCTCCTCGATCCCGCGGGGGGAAACCACCGCTCGTCTCGCCGGGCCCATTCGCTCCGGACAACGCAGCGGCTCG
CCAGCCCCGGGCCAGCAGCTCCCTGAGGGAGACTCTCCCTTGGTTGGCGGCCGTCCATTTTCTCAAGGCCCCGGC
GTGTCTGCCTTGGCGGCCGCCTTGTCCGACTCTTACGGTCAGTCGCCGCCACGCTACGGGACTCCTCCCGCCAGA
GTGACGTCGTCGCCGCCGAGGCCGACTTCACCCGGGCTCCCGCTCCGAACCGATACGCCTACCAATTATGGCTCC
TTCGACTCGAGGTCCCGTATGGGGCAGAGCGGCGCTGCCGGGCCGTATGAGGACCCAGAAATTATCAAGCGTCAT
CTAGTGCAGCCCGGCGAGTCGGAGAATTTGCCCTCGGAGGAATCCTCCACCCAAGGGCCCGTCCGCGGGAAGCAG
TCGGCCGAGCCCGGCACCGGCCTCAACGACGACGAATTCTCCAGTCTGAGGCTCCAGGGAGGTGACATCACCCGT
GGAATCTACAAGTGGACGGAGCAGGCCGAGGCCAAGGGCCGCCTCCATCGCAGTCGGAGCTTTCACCACCAACGC
CCCGAGCCTGAGACGGACGTGTTGGACATTAACTCCATCAAGGTCCCGGGCGGCTTCAGGAGGAACCATCTGCGT
CGAAACGCCATGAGCCCAAACCGCCAAGCCGAAGCCGACGAGTCGGGCGTCGAATCCCCCCCCGGGACCCAGCCG
CGGCTCTTCACCTCGAGCTTCCTCGAGTTTCTCACTATATACGGCCACTTTGCGGGTGAGGAGCTCGAGGAGGAC
GATGAAGCCCTCGGTCCCAACGAGGAGTTCTGGTCGGACCGGGCCGGACCCGGCGACGGCAGCGACGATGAGAGG
GAGCCCATGGAAGACAGCGCTCTTCTCACCCACTCAAAGAGGATGAGGCGGCGCAAGCCTCGTGGCGGCAGCGGC
AAGAATAGCCCCCTCAACGCCGCCCTCTTGCTGCTCAAGTCTTTTGTTGGCACCGGCGTATTGTTCCTCCCGCGC
GCCTATCTCAGCGGCGGTATGTTGCTTAGCAACCTGGTTCTGCTCTGCCTCGCCGGCTTGAGCTACTACAGCTTC
GTGTTGCTGGTGTCGACGCGGATTAGGGTCGAGGGCTCCTTTGGCGATATGGGCGGCATCCTCTATGGCAAATGG
ATGCGCACCCTGATCCTGGCCTCCATTGTCATTAGCCAGATAGGCTTCACCGCCGCCTATACCGTCTTTACGGCC
GAGAACCTGCAGGCTTTTATACGCGCCGTGTCCGACTGCCGGACGACCATCAGCATTCCGCTCCTGATTCTCATG
CAGACTCTCATTTTCCTGCCCTTTTCTTTGCTCCGGGACATTGGCAAGCTTGGCTTCACGGCGCTGATTGCCGAC
GCCTTCATTCTCATCGGCCTGGCCTACCTATTTTACTACGACGTCTTGACGCTCAGCAAGTTTGGACTCGCCGAC
ATCATCATGTTTAACGACAAGGACTGGACTCTCTTCATCGGCACGGCCATCTTTACCTTTGAGGGCATCGGCTTG
GTGATTCCCATCCAGGAATCGATGAAGCATCCGCAAAAGTTTCCTCGCGTGCTCTTTTACGTCATGATCATCATC
ACGGTCGTCTTCATCACTATGGGCGCCATCTCGTACGCGGCGTACGGATCCAAGACGGAGACGGTTGTGCTGCTC
AACCTGCCGCAAGACAACAAGCTTGTCAACGGCGTGCAGCTTCTCTACTCCATCGCCATCCTTTTATCGACACCG
CTGCAGATCTTTCCCGCGGTGCGCATTGTCGAGACGGAGCTGTTTACGCGCAGCGGCAAGTACAACCCCTACATC
AAGTGGCAGAAAAATATCTTTCGCTTCTTCGTCGTCATGCTCTGCGCCGCCATCTCCTGGGGCGGAGCCGATAAT
CTGGACAAGTTCGTGGCGCTGGTTGGCAACTTTGCCTGCATTCCGCTCGTCTACATCTATCCGCCCCTACTGCAC
TACAAGGCCGTGGCCAGAAACAGGGCGTGGAAGGTTGCTGACGTGGTGCTGTGCGTCTTTGGCTTCTTCGCCATG
GCGTACGCTACCAGCCTGACCATCATGAGCTGGGCGAACGCCGGAGCTAAGCCGCCGGGCTACTGCGAGAGGAGG
AATCCA
Transcript >Ophio5|2353
ATGTCGTCGCCCAAGAACCCAAACCCTTCCCTCGGGCCGTTGCCGTCTCCAGCCCCGGGCCATTCGCGATCGTTT
TCCTCCTCGATCCCGCGGGGGGAAACCACCGCTCGTCTCGCCGGGCCCATTCGCTCCGGACAACGCAGCGGCTCG
CCAGCCCCGGGCCAGCAGCTCCCTGAGGGAGACTCTCCCTTGGTTGGCGGCCGTCCATTTTCTCAAGGCCCCGGC
GTGTCTGCCTTGGCGGCCGCCTTGTCCGACTCTTACGGTCAGTCGCCGCCACGCTACGGGACTCCTCCCGCCAGA
GTGACGTCGTCGCCGCCGAGGCCGACTTCACCCGGGCTCCCGCTCCGAACCGATACGCCTACCAATTATGGCTCC
TTCGACTCGAGGTCCCGTATGGGGCAGAGCGGCGCTGCCGGGCCGTATGAGGACCCAGAAATTATCAAGCGTCAT
CTAGTGCAGCCCGGCGAGTCGGAGAATTTGCCCTCGGAGGAATCCTCCACCCAAGGGCCCGTCCGCGGGAAGCAG
TCGGCCGAGCCCGGCACCGGCCTCAACGACGACGAATTCTCCAGTCTGAGGCTCCAGGGAGGTGACATCACCCGT
GGAATCTACAAGTGGACGGAGCAGGCCGAGGCCAAGGGCCGCCTCCATCGCAGTCGGAGCTTTCACCACCAACGC
CCCGAGCCTGAGACGGACGTGTTGGACATTAACTCCATCAAGGTCCCGGGCGGCTTCAGGAGGAACCATCTGCGT
CGAAACGCCATGAGCCCAAACCGCCAAGCCGAAGCCGACGAGTCGGGCGTCGAATCCCCCCCCGGGACCCAGCCG
CGGCTCTTCACCTCGAGCTTCCTCGAGTTTCTCACTATATACGGCCACTTTGCGGGTGAGGAGCTCGAGGAGGAC
GATGAAGCCCTCGGTCCCAACGAGGAGTTCTGGTCGGACCGGGCCGGACCCGGCGACGGCAGCGACGATGAGAGG
GAGCCCATGGAAGACAGCGCTCTTCTCACCCACTCAAAGAGGATGAGGCGGCGCAAGCCTCGTGGCGGCAGCGGC
AAGAATAGCCCCCTCAACGCCGCCCTCTTGCTGCTCAAGTCTTTTGTTGGCACCGGCGTATTGTTCCTCCCGCGC
GCCTATCTCAGCGGCGGTATGTTGCTTAGCAACCTGGTTCTGCTCTGCCTCGCCGGCTTGAGCTACTACAGCTTC
GTGTTGCTGGTGTCGACGCGGATTAGGGTCGAGGGCTCCTTTGGCGATATGGGCGGCATCCTCTATGGCAAATGG
ATGCGCACCCTGATCCTGGCCTCCATTGTCATTAGCCAGATAGGCTTCACCGCCGCCTATACCGTCTTTACGGCC
GAGAACCTGCAGGCTTTTATACGCGCCGTGTCCGACTGCCGGACGACCATCAGCATTCCGCTCCTGATTCTCATG
CAGACTCTCATTTTCCTGCCCTTTTCTTTGCTCCGGGACATTGGCAAGCTTGGCTTCACGGCGCTGATTGCCGAC
GCCTTCATTCTCATCGGCCTGGCCTACCTATTTTACTACGACGTCTTGACGCTCAGCAAGTTTGGACTCGCCGAC
ATCATCATGTTTAACGACAAGGACTGGACTCTCTTCATCGGCACGGCCATCTTTACCTTTGAGGGCATCGGCTTG
GTGATTCCCATCCAGGAATCGATGAAGCATCCGCAAAAGTTTCCTCGCGTGCTCTTTTACGTCATGATCATCATC
ACGGTCGTCTTCATCACTATGGGCGCCATCTCGTACGCGGCGTACGGATCCAAGACGGAGACGGTTGTGCTGCTC
AACCTGCCGCAAGACAACAAGCTTGTCAACGGCGTGCAGCTTCTCTACTCCATCGCCATCCTTTTATCGACACCG
CTGCAGATCTTTCCCGCGGTGCGCATTGTCGAGACGGAGCTGTTTACGCGCAGCGGCAAGTACAACCCCTACATC
AAGTGGCAGAAAAATATCTTTCGCTTCTTCGTCGTCATGCTCTGCGCCGCCATCTCCTGGGGCGGAGCCGATAAT
CTGGACAAGTTCGTGGCGCTGGTTGGCAACTTTGCCTGCATTCCGCTCGTCTACATCTATCCGCCCCTACTGCAC
TACAAGGCCGTGGCCAGAAACAGGGCGTGGAAGGTTGCTGACGTGGTGCTGTGCGTCTTTGGCTTCTTCGCCATG
GCGTACGCTACCAGCCTGACCATCATGAGCTGGGCGAACGCCGGAGCTAAGCCGCCGGGCTACTGCGAGAGGAGG
AATCCATGA
Gene >Ophio5|2353
ATGTCGTCGCCCAAGAACCCAAACCCTTCCCTCGGGCCGTTGCCGTCTCCAGCCCCGGGCCATTCGCGATCGTTT
TCCTCCTCGATCCCGCGGGGGGAAACCACCGCTCGTCTCGCCGGGCCCATTCGCTCCGGACAACGCAGCGGCTCG
CCAGCCCCGGGCCAGCAGCTCCCTGAGGGAGACTCTCCCTTGGTTGGCGGCCGTCCATTTTCTCAAGGCCCCGGC
GTGTCTGCCTTGGCGGCCGCCTTGTCCGACTCTTACGGTCAGTCGCCGCCACGCTACGGGACTCCTCCCGCCAGA
GTGACGTCGTCGCCGCCGAGGCCGACTTCACCCGGGCTCCCGCTCCGAACCGATACGCCTACCAATTATGGCTCC
TTCGACTCGAGGTCCCGTATGGGGCAGAGCGGCGCTGCCGGGCCGTATGAGGACCCAGAAATTATCAAGCGTCAT
CTAGTGCAGCCCGGCGAGTCGGAGAATTTGCCCTCGGAGGAATCCTCCACCCAAGGGCCCGTCCGCGGGAAGCAG
TCGGCCGAGCCCGGCACCGGCCTCAACGACGACGAATTCTCCAGTCTGAGGCTCCAGGGAGGTGACATCACCCGT
GGAATCTACAAGTGGACGGAGCAGGCCGAGGCCAAGGGCCGCCTCCATCGCAGTCGGAGCTTTCACCACCAACGC
CCCGAGCCTGAGACGGACGTGTTGGACATTAACTCCATCAAGGTCCCGGGCGGCTTCAGGAGGAACCATCTGCGT
CGAAACGCCATGAGCCCAAACCGCCAAGCCGAAGCCGACGAGTCGGGCGTCGAATCCCCCCCCGGGACCCAGCCG
CGGCTCTTCACCTCGAGCTTCCTCGAGTTTCTCACTATATACGGCCACTTTGCGGGTGAGGAGCTCGAGGAGGAC
GATGAAGCCCTCGGTCCCAACGAGGAGTTCTGGTCGGACCGGGCCGGACCCGGCGACGGCAGCGACGATGAGAGG
GAGCCCATGGAAGACAGCGCTCTTCTCACCCACTCAAAGAGGATGAGGCGGCGCAAGCCTCGTGGCGGCAGCGGC
AAGAATAGCCCCCTCAACGCCGCCCTCTTGCTGCTCAAGTCTTTTGTTGGCACCGGCGTATTGTTCCTCCCGCGC
GCCTATCTCAGCGGCGGTATGTTGCTTAGCAACCTGGTTCTGCTCTGCCTCGCCGGCTTGAGCTACTACAGCTTC
GTGTTGCTGGTGTCGACGCGGATTAGGGTCGAGGGCTCCTTTGGCGATATGGGCGGCATCCTCTATGGCAAATGG
ATGCGCACCCTGATCCTGGCCTCCATTGTCATTAGCCAGATAGGCTTCACCGCCGCCTATACCGTCTTTACGGCC
GAGAACCTGCAGGCTTTTATACGCGCCGTGTCCGACTGCCGGACGACCATCAGCATTCCGCTCCTGATTCTCATG
CAGACTCTCATTTTCCTGCCCTTTTCTTTGCTCCGGGACATTGGCAAGCTTGGCTTCACGGCGCTGATTGCCGAC
GCCTTCATTCTCATCGGCCTGGCCTACCTATTTTACTACGACGTCTTGACGCTCAGCAAGTTTGGACTCGCCGAC
ATCATCATGTTTAACGACAAGGACTGGACTCTCTTCATCGGCACGGCCATCTTTACCTTTGAGGGCATCGGCTTG
GTGATTCCCATCCAGGAATCGATGAAGCATCCGCAAAAGTTTCCTCGCGTGCTCTTTTACGTCATGATCATCATC
ACGGTCGTCTTCATCACTATGGGCGCCATCTCGTACGCGGCGTACGGATCCAAGACGGAGACGGTTGTGCTGCTC
AACCTGCCGCAAGACAACAAGCTTGTCAACGGCGTGCAGCTTCTCTACTCCATCGCCATCCTTTTATCGACACCG
CTGCAGATCTTTCCCGCGGTGCGCATTGTCGAGACGGAGCTGTTTACGCGCAGCGGCAAGTACAACCCCTACATC
AAGTGGCAGAAAAATATCTTTCGCTTCTTCGTCGTCATGCTCTGCGCCGCCATCTCCTGGGGCGGAGCCGATAAT
CTGGACAAGTTCGTGGCGCTGGTTGGCAACTTTGCCTGCATTCCGCTCGTCTACATCTATCCGGTAAATAGCCCT
TTCTGCTTCCTCTGCTTCTCCTTGTTCCTCCTTATGGCCGCGACTAACGCGCTTTACAGCCCCTACTGCACTACA
AGGCCGTGGCCAGAAACAGGGCGTGGAAGGTTGCTGACGTGGTGCTGTGCGTCTTTGGCTTCTTCGCCATGGCGT
ACGCTACCAGCCTGACCATCATGAGCTGGGCGAACGCCGGAGCTAAGCCGCCGGGCTACTGCGAGAGGAGGAATC
CATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail