Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2352
Gene name
Locationscaffold_2:54005..57996
Strand-
Gene length (bp)3991
Transcript length (bp)3705
Coding sequence length (bp)3702
Protein length (aa) 1234

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00324 AA_permease Amino acid permease 1.5E-53 24 489
PF03522 SLC12 Solute carrier family 12 1.6E-08 501 588
PF03522 SLC12 Solute carrier family 12 1.7E-06 1167 1230
PF13520 AA_permease_2 Amino acid permease 1.2E-15 33 467

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38329|VHC1_YEAST Vacuolar cation-chloride cotransporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHC1 PE=1 SV=1 10 820 0.0E+00
sp|O60146|YNSG_SCHPO Uncharacterized transporter C18H10.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18H10.16 PE=1 SV=2 5 826 0.0E+00
sp|Q0VGW6|S12A9_XENLA Solute carrier family 12 member 9 OS=Xenopus laevis GN=slc12a9 PE=2 SV=1 5 775 1.0E-132
sp|A2BFP5|S12A9_DANRE Solute carrier family 12 member 9 OS=Danio rerio GN=slc12a9 PE=3 SV=1 6 777 1.0E-121
sp|Q99MR3|S12A9_MOUSE Solute carrier family 12 member 9 OS=Mus musculus GN=Slc12a9 PE=1 SV=2 17 806 2.0E-117
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38329|VHC1_YEAST Vacuolar cation-chloride cotransporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHC1 PE=1 SV=1 10 820 0.0E+00
sp|O60146|YNSG_SCHPO Uncharacterized transporter C18H10.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18H10.16 PE=1 SV=2 5 826 0.0E+00
sp|Q0VGW6|S12A9_XENLA Solute carrier family 12 member 9 OS=Xenopus laevis GN=slc12a9 PE=2 SV=1 5 775 1.0E-132
sp|A2BFP5|S12A9_DANRE Solute carrier family 12 member 9 OS=Danio rerio GN=slc12a9 PE=3 SV=1 6 777 1.0E-121
sp|Q99MR3|S12A9_MOUSE Solute carrier family 12 member 9 OS=Mus musculus GN=Slc12a9 PE=1 SV=2 17 806 2.0E-117
sp|Q66HR0|S12A9_RAT Solute carrier family 12 member 9 OS=Rattus norvegicus GN=Slc12a9 PE=1 SV=1 3 806 4.0E-117
sp|Q9BXP2|S12A9_HUMAN Solute carrier family 12 member 9 OS=Homo sapiens GN=SLC12A9 PE=1 SV=1 17 806 3.0E-116
sp|Q25479|NKCL_MANSE Bumetanide-sensitive sodium-(potassium)-chloride cotransporter OS=Manduca sexta PE=2 SV=1 10 587 5.0E-75
sp|P55017|S12A3_HUMAN Solute carrier family 12 member 3 OS=Homo sapiens GN=SLC12A3 PE=1 SV=3 11 587 4.0E-74
sp|P59158|S12A3_MOUSE Solute carrier family 12 member 3 OS=Mus musculus GN=Slc12a3 PE=1 SV=1 12 587 1.0E-72
sp|P55018|S12A3_RAT Solute carrier family 12 member 3 OS=Rattus norvegicus GN=Slc12a3 PE=2 SV=2 12 587 1.0E-72
sp|P55013|S12A2_SQUAC Solute carrier family 12 member 2 OS=Squalus acanthias GN=SLC12A2 PE=1 SV=1 17 587 4.0E-72
sp|P55011|S12A2_HUMAN Solute carrier family 12 member 2 OS=Homo sapiens GN=SLC12A2 PE=1 SV=1 17 820 5.0E-72
sp|P55012|S12A2_MOUSE Solute carrier family 12 member 2 OS=Mus musculus GN=Slc12a2 PE=1 SV=2 17 820 7.0E-71
sp|P55016|S12A1_RAT Solute carrier family 12 member 1 OS=Rattus norvegicus GN=Slc12a1 PE=1 SV=1 8 587 5.0E-70
sp|P55014|S12A1_MOUSE Solute carrier family 12 member 1 OS=Mus musculus GN=Slc12a1 PE=1 SV=2 8 587 1.0E-68
sp|Q657W3|CCC2_ORYSJ Cation-chloride cotransporter 2 OS=Oryza sativa subsp. japonica GN=CCC2 PE=2 SV=2 17 603 9.0E-68
sp|P55019|S12A3_PSEAM Solute carrier family 12 member 3 OS=Pseudopleuronectes americanus GN=slc12a3 PE=2 SV=1 17 587 5.0E-67
sp|P55015|S12A1_RABIT Solute carrier family 12 member 1 OS=Oryctolagus cuniculus GN=SLC12A1 PE=2 SV=1 8 587 9.0E-67
sp|Q13621|S12A1_HUMAN Solute carrier family 12 member 1 OS=Homo sapiens GN=SLC12A1 PE=1 SV=2 8 587 5.0E-66
sp|Q2UVJ5|CCC1_ARATH Cation-chloride cotransporter 1 OS=Arabidopsis thaliana GN=CCC1 PE=1 SV=1 17 603 8.0E-65
sp|Q6Z0E2|CCC1_ORYSJ Cation-chloride cotransporter 1 OS=Oryza sativa subsp. japonica GN=CCC1 PE=2 SV=1 3 603 3.0E-64
sp|Q9UHW9|S12A6_HUMAN Solute carrier family 12 member 6 OS=Homo sapiens GN=SLC12A6 PE=1 SV=2 224 589 6.0E-50
sp|Q924N4|S12A6_MOUSE Solute carrier family 12 member 6 OS=Mus musculus GN=Slc12a6 PE=1 SV=2 224 589 1.0E-49
sp|Q63632|S12A4_RAT Solute carrier family 12 member 4 OS=Rattus norvegicus GN=Slc12a4 PE=1 SV=1 224 587 3.0E-49
sp|Q9UP95|S12A4_HUMAN Solute carrier family 12 member 4 OS=Homo sapiens GN=SLC12A4 PE=1 SV=2 224 587 7.0E-49
sp|Q9JIS8|S12A4_MOUSE Solute carrier family 12 member 4 OS=Mus musculus GN=Slc12a4 PE=1 SV=2 224 587 9.0E-49
sp|Q28677|S12A4_RABIT Solute carrier family 12 member 4 OS=Oryctolagus cuniculus GN=SLC12A4 PE=1 SV=1 224 587 2.0E-48
sp|Q9Y666|S12A7_HUMAN Solute carrier family 12 member 7 OS=Homo sapiens GN=SLC12A7 PE=1 SV=3 223 587 3.0E-48
sp|Q5RK27|S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus GN=Slc12a7 PE=2 SV=2 222 587 3.0E-48
sp|Q9WVL3|S12A7_MOUSE Solute carrier family 12 member 7 OS=Mus musculus GN=Slc12a7 PE=1 SV=1 222 587 4.0E-48
sp|Q7YRU6|S12A7_RABIT Solute carrier family 12 member 7 OS=Oryctolagus cuniculus GN=SLC12A7 PE=1 SV=1 225 587 5.0E-47
sp|Q91V14|S12A5_MOUSE Solute carrier family 12 member 5 OS=Mus musculus GN=Slc12a5 PE=1 SV=2 225 587 1.0E-46
sp|Q63633|S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus GN=Slc12a5 PE=1 SV=2 225 587 1.0E-46
sp|Q9H2X9|S12A5_HUMAN Solute carrier family 12 member 5 OS=Homo sapiens GN=SLC12A5 PE=2 SV=3 225 587 3.0E-46
sp|Q8VI23|S12A8_MOUSE Solute carrier family 12 member 8 OS=Mus musculus GN=Slc12a8 PE=2 SV=2 18 406 9.0E-36
sp|A0AV02|S12A8_HUMAN Solute carrier family 12 member 8 OS=Homo sapiens GN=SLC12A8 PE=2 SV=4 18 401 1.0E-33
sp|Q6A4L1|S12A8_XENLA Solute carrier family 12 member 8 OS=Xenopus laevis GN=slc12a8 PE=2 SV=1 18 394 8.0E-30
sp|Q8CJI3|S12A8_RAT Solute carrier family 12 member 8 OS=Rattus norvegicus GN=Slc12a8 PE=2 SV=1 18 398 3.0E-28
sp|Q09573|KCC3_CAEEL Sodium/chloride cotransporter 3 OS=Caenorhabditis elegans GN=kcc-3 PE=4 SV=1 184 589 4.0E-28
sp|Q924N4|S12A6_MOUSE Solute carrier family 12 member 6 OS=Mus musculus GN=Slc12a6 PE=1 SV=2 12 122 3.0E-21
sp|Q9UHW9|S12A6_HUMAN Solute carrier family 12 member 6 OS=Homo sapiens GN=SLC12A6 PE=1 SV=2 12 122 4.0E-21
sp|Q9JIS8|S12A4_MOUSE Solute carrier family 12 member 4 OS=Mus musculus GN=Slc12a4 PE=1 SV=2 13 179 2.0E-20
sp|Q28677|S12A4_RABIT Solute carrier family 12 member 4 OS=Oryctolagus cuniculus GN=SLC12A4 PE=1 SV=1 13 122 2.0E-20
sp|Q63632|S12A4_RAT Solute carrier family 12 member 4 OS=Rattus norvegicus GN=Slc12a4 PE=1 SV=1 13 189 2.0E-20
sp|Q9UP95|S12A4_HUMAN Solute carrier family 12 member 4 OS=Homo sapiens GN=SLC12A4 PE=1 SV=2 18 122 3.0E-20
sp|Q09573|KCC3_CAEEL Sodium/chloride cotransporter 3 OS=Caenorhabditis elegans GN=kcc-3 PE=4 SV=1 6 124 2.0E-19
sp|Q63633|S12A5_RAT Solute carrier family 12 member 5 OS=Rattus norvegicus GN=Slc12a5 PE=1 SV=2 2 122 8.0E-19
sp|Q91V14|S12A5_MOUSE Solute carrier family 12 member 5 OS=Mus musculus GN=Slc12a5 PE=1 SV=2 2 122 9.0E-19
sp|Q9H2X9|S12A5_HUMAN Solute carrier family 12 member 5 OS=Homo sapiens GN=SLC12A5 PE=2 SV=3 2 122 9.0E-19
sp|Q9WVL3|S12A7_MOUSE Solute carrier family 12 member 7 OS=Mus musculus GN=Slc12a7 PE=1 SV=1 17 122 1.0E-18
sp|Q9Y666|S12A7_HUMAN Solute carrier family 12 member 7 OS=Homo sapiens GN=SLC12A7 PE=1 SV=3 13 122 1.0E-18
sp|Q5RK27|S12A7_RAT Solute carrier family 12 member 7 OS=Rattus norvegicus GN=Slc12a7 PE=2 SV=2 17 122 1.0E-18
sp|Q7YRU6|S12A7_RABIT Solute carrier family 12 member 7 OS=Oryctolagus cuniculus GN=SLC12A7 PE=1 SV=1 10 122 4.0E-18
sp|P38329|VHC1_YEAST Vacuolar cation-chloride cotransporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHC1 PE=1 SV=1 1014 1234 5.0E-17
sp|O60146|YNSG_SCHPO Uncharacterized transporter C18H10.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18H10.16 PE=1 SV=2 1147 1234 2.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0006811 ion transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 49 71 22
3 99 121 22
4 134 156 22
5 166 185 19
6 222 244 22
7 259 281 22
8 294 316 22
9 351 369 18
10 374 396 22
11 411 430 19
12 435 452 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2352
MSPSTTGPGPDPARNGKLGIMSGVFIPVFLSIMSILMFLRFGLILGQVGLVGIAGLLLVAYCINLLTTLSLSAIA
SNGEVKGGGAYFVISRSLGPEFGGSIGLLFFVAQALNTALNIIGLIDSIRLNAGDAFPTGYWAGYALQTAALVLC
TALCLLGSSTFSKASAALLTLLTLAVISIPVSIVFKSPFHDKATGVQFTGFSLDTLMANLLPRDDSPEYHGLATF
RELFGILFPATAGIFAGASMSGDLKDPSKAIPAGTLWATLTTLVVYAIVVLSLAASTTRESLLANNNVLFLTNIF
PPIILAGECSVTFVSALICMMGCANLFQALARDRVLPGLSVFGKGSRKSDVAFTAILLTYALVQVALLADLNRIA
ALISMGYQMTFLVMNLACFLLKIGSAPNFRPGFKFFSWQTALAGSLLSAAAMFFIHETYAAVAICLLCFLFLLIH
YLCPPKRWGDVSQNLIYHQVRKYLLRLRPEHIKFWRPHIILLINDPRRQNRLIQFCNSMKKGSLYILGHVIVTED
FDSGVGEARLQQQAWSNYISEFSRIKAFLQLTMSPSLVWGIRNLILSAGLGGMRPNIAVLGFYNMDDLRRSKPMI
PIPDLPAASSKPRRPFWADGKAPVRRREDSSSRLLTGSLPTDVIRTEGPMSPTDYMLVLEDLALKYRLNVAVAYG
FESLETPRDDGANTKKYIDLWPIQMSAEVAADGKNVLTTNFDTYTLILQLGHILRSVRDWRRVYSLRVMVFVEYE
SEVDEESARLKALLEKLRIEAEVLVFWLAAGQLGTYELIVNGRTGDGGAEKMVDDALRHEEWWDDLQTYRGQAGE
AGLNREAHQLVLSLDAAAGRAAVFDEGVGSRRRHSVTEVDGMPRNPDIGLLNKWGVNVGIHTHRLPENVLRQPEM
DDALRTITECSDSDEEYGFASEHVVTAKPLSPVRRPLLRASGQSAPGPSSHREVGHGRWPEDTDGTLSSHTAAFE
GIPKLVETTASPSPTREEGSRMAMGSSPARHAPVPVPSAVSLDANDRSRSQSPTSGLSARALGEAPVTPMRPSFS
RQSSASRFSSRPVPETRVVAEAEGPTLSFAPMDSTPASQRVERPAHSRQSSWSKPFSRVSKADVAGESQARGAPR
PPLPRQHSRHGSQHSYFGAQDGSSYSTQSVALSFNDLPSRAQHLILNELMRQHSTDTAVLMSTLPIPSEGTSLDE
AATIRYLSDVEILCHGLPPTMMVLSNNMTVTVSL
Coding >Ophio5|2352
ATGTCCCCTTCCACCACCGGGCCCGGTCCCGATCCGGCGCGGAACGGAAAGTTGGGCATCATGTCGGGCGTCTTT
ATTCCCGTCTTCCTCAGCATCATGAGCATTCTCATGTTCCTGCGTTTCGGACTCATCCTTGGCCAGGTTGGCCTT
GTCGGCATTGCAGGCCTTCTCCTCGTGGCTTACTGCATCAATCTATTGACTACCCTCTCGTTGTCCGCCATAGCA
TCCAACGGCGAGGTGAAGGGAGGAGGCGCCTACTTCGTCATCTCGCGCTCCCTTGGCCCCGAGTTCGGTGGCTCT
ATTGGACTTCTCTTTTTCGTCGCTCAGGCGCTGAATACCGCCCTCAACATCATCGGACTCATCGACTCCATCCGC
CTCAACGCCGGAGACGCCTTCCCTACCGGCTACTGGGCCGGATACGCCCTGCAGACGGCTGCCCTGGTTCTCTGC
ACCGCATTGTGCCTTTTGGGGTCGTCGACCTTTTCCAAGGCTTCTGCTGCTTTGTTGACCTTGTTAACCCTCGCC
GTCATAAGCATCCCTGTCTCAATCGTCTTCAAGTCGCCTTTCCACGATAAAGCTACTGGCGTTCAATTCACCGGC
TTTAGCCTCGACACGCTCATGGCCAACCTGCTCCCTCGCGACGACAGCCCCGAGTATCATGGGTTGGCCACTTTT
CGCGAGCTCTTTGGCATCCTCTTTCCGGCCACGGCAGGCATCTTTGCCGGCGCCTCCATGTCGGGCGACTTGAAG
GACCCGAGCAAGGCCATCCCCGCTGGCACGCTATGGGCTACATTGACAACCCTTGTTGTCTACGCAATCGTCGTT
CTTTCCCTGGCCGCCAGCACCACCCGCGAGTCGCTTCTCGCCAATAACAACGTCCTGTTTCTTACCAATATTTTC
CCGCCCATCATTCTCGCGGGAGAGTGCTCTGTCACTTTCGTCTCGGCTCTCATCTGCATGATGGGCTGTGCGAAC
CTGTTCCAGGCCCTCGCCAGAGACCGCGTCCTACCCGGCTTGTCCGTCTTCGGCAAGGGCTCGAGGAAGAGCGAT
GTGGCCTTTACCGCCATCCTCTTGACTTATGCTCTGGTTCAGGTCGCCTTGCTGGCAGATCTGAATCGCATTGCC
GCCCTCATCTCCATGGGCTATCAGATGACCTTTCTTGTCATGAATCTCGCCTGTTTCCTTCTCAAGATCGGGTCG
GCGCCCAACTTCCGCCCGGGCTTCAAGTTCTTTAGCTGGCAGACGGCGCTCGCTGGCAGCCTACTGTCGGCCGCC
GCCATGTTCTTCATACACGAGACCTACGCGGCCGTTGCCATCTGCCTCCTCTGCTTCCTCTTCCTGCTTATTCAC
TACCTCTGCCCGCCGAAGCGGTGGGGGGACGTCTCGCAGAACCTCATCTATCACCAGGTCAGAAAATATCTGCTG
CGCCTGCGGCCCGAGCACATCAAGTTCTGGAGGCCTCACATTATTCTGCTCATCAACGACCCACGTCGTCAAAAC
CGGTTGATTCAGTTCTGCAACTCGATGAAAAAGGGGTCTTTGTACATTCTTGGGCATGTCATCGTGACGGAAGAC
TTCGACAGCGGCGTCGGCGAGGCCCGTCTCCAACAACAGGCCTGGAGCAATTACATATCCGAGTTTTCCAGGATC
AAGGCCTTTCTGCAGCTGACAATGTCTCCTTCCCTCGTTTGGGGCATCCGGAATCTGATACTATCGGCTGGTTTG
GGTGGCATGCGACCGAACATTGCCGTCTTGGGCTTCTACAATATGGACGACCTCCGCCGGTCTAAGCCCATGATC
CCAATACCCGATCTTCCTGCGGCCTCGTCCAAGCCGCGACGGCCGTTTTGGGCCGACGGCAAGGCCCCTGTGCGA
CGGAGAGAGGACTCGTCATCTCGTCTATTGACAGGGTCCTTACCGACTGACGTGATCCGGACCGAGGGCCCTATG
TCTCCGACGGATTATATGCTCGTGTTGGAGGACCTGGCACTCAAATATCGCCTCAACGTCGCTGTGGCGTACGGG
TTCGAGTCGCTGGAGACACCGCGAGATGATGGTGCCAACACGAAGAAGTACATCGATCTGTGGCCTATACAGATG
TCCGCCGAGGTTGCCGCCGATGGCAAGAATGTCTTGACGACAAACTTTGACACTTACACTCTCATACTTCAGCTG
GGCCACATACTACGGAGCGTACGCGACTGGCGACGTGTCTACTCGCTTCGCGTCATGGTCTTTGTGGAATACGAA
AGTGAGGTGGACGAAGAGTCGGCGCGGTTGAAGGCGCTGCTGGAAAAGCTGCGGATCGAAGCCGAGGTTCTCGTT
TTCTGGCTTGCAGCCGGACAGTTGGGCACGTACGAACTCATCGTTAACGGTAGAACCGGTGATGGCGGGGCCGAG
AAGATGGTCGACGACGCACTACGGCACGAGGAATGGTGGGACGACCTGCAGACGTACCGCGGACAGGCTGGCGAG
GCCGGACTGAATCGAGAGGCACATCAGTTGGTGCTATCCCTCGACGCTGCGGCTGGACGAGCGGCCGTTTTCGAC
GAGGGCGTCGGCAGTCGACGGCGTCATAGCGTGACGGAAGTTGATGGGATGCCGAGGAATCCCGACATTGGCCTT
TTGAACAAATGGGGAGTCAACGTGGGCATACACACTCATCGCCTTCCTGAAAACGTTCTTCGCCAGCCGGAGATG
GACGACGCCCTGCGGACCATTACCGAATGTTCTGACTCGGATGAAGAGTACGGTTTCGCTTCAGAGCATGTCGTC
ACGGCCAAGCCCTTGAGCCCGGTGAGACGACCATTGCTCAGGGCCTCTGGGCAATCAGCTCCGGGCCCGTCGAGC
CATCGCGAAGTCGGACACGGACGCTGGCCTGAGGACACGGACGGAACCCTGTCGTCGCACACGGCTGCCTTTGAG
GGCATTCCCAAGCTTGTAGAGACAACGGCCAGTCCGTCGCCTACGCGCGAAGAGGGCTCTCGCATGGCCATGGGA
TCATCTCCAGCCCGTCACGCGCCGGTTCCGGTGCCCTCAGCCGTCTCCCTCGATGCAAACGATCGGTCGCGATCC
CAGAGCCCGACGAGCGGCTTGAGCGCTCGGGCACTGGGGGAGGCACCCGTTACGCCCATGCGACCCAGCTTCTCC
CGACAGTCTTCGGCCTCACGTTTCTCCTCTCGACCGGTTCCTGAGACGAGAGTCGTGGCGGAAGCTGAGGGGCCC
ACGCTTAGCTTCGCGCCCATGGACTCGACACCGGCGTCGCAGAGGGTCGAGCGGCCCGCCCATTCGAGGCAGTCT
TCTTGGAGCAAGCCTTTCAGCAGGGTGTCCAAGGCTGATGTCGCAGGAGAGTCTCAAGCGCGCGGGGCTCCTCGT
CCGCCTCTGCCGCGACAACATTCGCGACACGGTTCGCAGCACTCTTATTTTGGGGCCCAAGACGGCTCGTCGTAC
TCGACGCAGAGCGTGGCGCTGTCGTTCAACGACCTCCCCAGCCGGGCCCAGCATCTGATTCTCAATGAGCTGATG
CGTCAGCACTCGACGGACACGGCTGTTCTCATGAGCACGTTGCCCATACCCAGCGAAGGGACGAGTCTGGACGAG
GCGGCGACGATTCGATATCTCTCTGATGTGGAGATTTTGTGTCATGGGCTGCCGCCGACGATGATGGTTTTGAGC
AATAACATGACGGTTACGGTGAGCCTG
Transcript >Ophio5|2352
ATGTCCCCTTCCACCACCGGGCCCGGTCCCGATCCGGCGCGGAACGGAAAGTTGGGCATCATGTCGGGCGTCTTT
ATTCCCGTCTTCCTCAGCATCATGAGCATTCTCATGTTCCTGCGTTTCGGACTCATCCTTGGCCAGGTTGGCCTT
GTCGGCATTGCAGGCCTTCTCCTCGTGGCTTACTGCATCAATCTATTGACTACCCTCTCGTTGTCCGCCATAGCA
TCCAACGGCGAGGTGAAGGGAGGAGGCGCCTACTTCGTCATCTCGCGCTCCCTTGGCCCCGAGTTCGGTGGCTCT
ATTGGACTTCTCTTTTTCGTCGCTCAGGCGCTGAATACCGCCCTCAACATCATCGGACTCATCGACTCCATCCGC
CTCAACGCCGGAGACGCCTTCCCTACCGGCTACTGGGCCGGATACGCCCTGCAGACGGCTGCCCTGGTTCTCTGC
ACCGCATTGTGCCTTTTGGGGTCGTCGACCTTTTCCAAGGCTTCTGCTGCTTTGTTGACCTTGTTAACCCTCGCC
GTCATAAGCATCCCTGTCTCAATCGTCTTCAAGTCGCCTTTCCACGATAAAGCTACTGGCGTTCAATTCACCGGC
TTTAGCCTCGACACGCTCATGGCCAACCTGCTCCCTCGCGACGACAGCCCCGAGTATCATGGGTTGGCCACTTTT
CGCGAGCTCTTTGGCATCCTCTTTCCGGCCACGGCAGGCATCTTTGCCGGCGCCTCCATGTCGGGCGACTTGAAG
GACCCGAGCAAGGCCATCCCCGCTGGCACGCTATGGGCTACATTGACAACCCTTGTTGTCTACGCAATCGTCGTT
CTTTCCCTGGCCGCCAGCACCACCCGCGAGTCGCTTCTCGCCAATAACAACGTCCTGTTTCTTACCAATATTTTC
CCGCCCATCATTCTCGCGGGAGAGTGCTCTGTCACTTTCGTCTCGGCTCTCATCTGCATGATGGGCTGTGCGAAC
CTGTTCCAGGCCCTCGCCAGAGACCGCGTCCTACCCGGCTTGTCCGTCTTCGGCAAGGGCTCGAGGAAGAGCGAT
GTGGCCTTTACCGCCATCCTCTTGACTTATGCTCTGGTTCAGGTCGCCTTGCTGGCAGATCTGAATCGCATTGCC
GCCCTCATCTCCATGGGCTATCAGATGACCTTTCTTGTCATGAATCTCGCCTGTTTCCTTCTCAAGATCGGGTCG
GCGCCCAACTTCCGCCCGGGCTTCAAGTTCTTTAGCTGGCAGACGGCGCTCGCTGGCAGCCTACTGTCGGCCGCC
GCCATGTTCTTCATACACGAGACCTACGCGGCCGTTGCCATCTGCCTCCTCTGCTTCCTCTTCCTGCTTATTCAC
TACCTCTGCCCGCCGAAGCGGTGGGGGGACGTCTCGCAGAACCTCATCTATCACCAGGTCAGAAAATATCTGCTG
CGCCTGCGGCCCGAGCACATCAAGTTCTGGAGGCCTCACATTATTCTGCTCATCAACGACCCACGTCGTCAAAAC
CGGTTGATTCAGTTCTGCAACTCGATGAAAAAGGGGTCTTTGTACATTCTTGGGCATGTCATCGTGACGGAAGAC
TTCGACAGCGGCGTCGGCGAGGCCCGTCTCCAACAACAGGCCTGGAGCAATTACATATCCGAGTTTTCCAGGATC
AAGGCCTTTCTGCAGCTGACAATGTCTCCTTCCCTCGTTTGGGGCATCCGGAATCTGATACTATCGGCTGGTTTG
GGTGGCATGCGACCGAACATTGCCGTCTTGGGCTTCTACAATATGGACGACCTCCGCCGGTCTAAGCCCATGATC
CCAATACCCGATCTTCCTGCGGCCTCGTCCAAGCCGCGACGGCCGTTTTGGGCCGACGGCAAGGCCCCTGTGCGA
CGGAGAGAGGACTCGTCATCTCGTCTATTGACAGGGTCCTTACCGACTGACGTGATCCGGACCGAGGGCCCTATG
TCTCCGACGGATTATATGCTCGTGTTGGAGGACCTGGCACTCAAATATCGCCTCAACGTCGCTGTGGCGTACGGG
TTCGAGTCGCTGGAGACACCGCGAGATGATGGTGCCAACACGAAGAAGTACATCGATCTGTGGCCTATACAGATG
TCCGCCGAGGTTGCCGCCGATGGCAAGAATGTCTTGACGACAAACTTTGACACTTACACTCTCATACTTCAGCTG
GGCCACATACTACGGAGCGTACGCGACTGGCGACGTGTCTACTCGCTTCGCGTCATGGTCTTTGTGGAATACGAA
AGTGAGGTGGACGAAGAGTCGGCGCGGTTGAAGGCGCTGCTGGAAAAGCTGCGGATCGAAGCCGAGGTTCTCGTT
TTCTGGCTTGCAGCCGGACAGTTGGGCACGTACGAACTCATCGTTAACGGTAGAACCGGTGATGGCGGGGCCGAG
AAGATGGTCGACGACGCACTACGGCACGAGGAATGGTGGGACGACCTGCAGACGTACCGCGGACAGGCTGGCGAG
GCCGGACTGAATCGAGAGGCACATCAGTTGGTGCTATCCCTCGACGCTGCGGCTGGACGAGCGGCCGTTTTCGAC
GAGGGCGTCGGCAGTCGACGGCGTCATAGCGTGACGGAAGTTGATGGGATGCCGAGGAATCCCGACATTGGCCTT
TTGAACAAATGGGGAGTCAACGTGGGCATACACACTCATCGCCTTCCTGAAAACGTTCTTCGCCAGCCGGAGATG
GACGACGCCCTGCGGACCATTACCGAATGTTCTGACTCGGATGAAGAGTACGGTTTCGCTTCAGAGCATGTCGTC
ACGGCCAAGCCCTTGAGCCCGGTGAGACGACCATTGCTCAGGGCCTCTGGGCAATCAGCTCCGGGCCCGTCGAGC
CATCGCGAAGTCGGACACGGACGCTGGCCTGAGGACACGGACGGAACCCTGTCGTCGCACACGGCTGCCTTTGAG
GGCATTCCCAAGCTTGTAGAGACAACGGCCAGTCCGTCGCCTACGCGCGAAGAGGGCTCTCGCATGGCCATGGGA
TCATCTCCAGCCCGTCACGCGCCGGTTCCGGTGCCCTCAGCCGTCTCCCTCGATGCAAACGATCGGTCGCGATCC
CAGAGCCCGACGAGCGGCTTGAGCGCTCGGGCACTGGGGGAGGCACCCGTTACGCCCATGCGACCCAGCTTCTCC
CGACAGTCTTCGGCCTCACGTTTCTCCTCTCGACCGGTTCCTGAGACGAGAGTCGTGGCGGAAGCTGAGGGGCCC
ACGCTTAGCTTCGCGCCCATGGACTCGACACCGGCGTCGCAGAGGGTCGAGCGGCCCGCCCATTCGAGGCAGTCT
TCTTGGAGCAAGCCTTTCAGCAGGGTGTCCAAGGCTGATGTCGCAGGAGAGTCTCAAGCGCGCGGGGCTCCTCGT
CCGCCTCTGCCGCGACAACATTCGCGACACGGTTCGCAGCACTCTTATTTTGGGGCCCAAGACGGCTCGTCGTAC
TCGACGCAGAGCGTGGCGCTGTCGTTCAACGACCTCCCCAGCCGGGCCCAGCATCTGATTCTCAATGAGCTGATG
CGTCAGCACTCGACGGACACGGCTGTTCTCATGAGCACGTTGCCCATACCCAGCGAAGGGACGAGTCTGGACGAG
GCGGCGACGATTCGATATCTCTCTGATGTGGAGATTTTGTGTCATGGGCTGCCGCCGACGATGATGGTTTTGAGC
AATAACATGACGGTTACGGTGAGCCTGTGA
Gene >Ophio5|2352
ATGTCCCCTTCCACCACCGGGCCCGGTCCCGATCCGGCGCGGAACGGAAAGTTGGGCATCATGTCGGGCGTCTTT
ATTCCCGTCTTCCTCAGCATCATGAGCATTCTCATGTTCCTGCGTTTCGGACTCATCCTTGGCCAGGTTGGCCTT
GTCGGCATTGCAGGTACGCTCCCACTTCGGCACTGGCCGCTGACATGGTGTTGATCCAGCCGTCTAGGCCTTCTC
CTCGTGGCTTACTGCATCAATCTATTGACTACCCTCTCGTTGTCCGCCATAGCATCCAACGGCGAGGTGAAGGGA
GGAGGCGCCTACTTCGTCATCTCGCGCTCCCTTGGCCCCGAGTTCGGTGGCTCTATTGGACTTCTCTTTTTCGTC
GCTCAGGCGCTGAATACCGCCCTCAACATCATCGGACTCATCGACTCCATCCGCCTCAACGCCGGAGACGCCTTC
CCTACCGGCTACTGGGCCGGATACGCCCTGCAGACGGCTGCCCTGGTTCTCTGCACCGCATTGTGCCTTTTGGGG
TCGTCGACCTTTTCCAAGGCTTCTGCTGCTTTGTTGACCTTGTTAACCCTCGCCGTCATAAGCATCCCTGTCTCA
ATCGTCTTCAAGTCGCCTTTCCACGATAAAGCTACTGGCGTTCAATTCACCGGCTTTAGCCTCGACACGCTCATG
GCCAACCTGCTCCCTCGCGACGACAGCCCCGAGTATCATGGGTTGGCCACTTTTCGCGAGCTCTTTGGCATCCTC
TTTCCGTGCGTCATGGTCTCAGTGAACATTACGCCCCATCATGCTGACAACCTTTAGGGCCACGGCAGGCATCTT
TGCCGGCGCCTCCATGTCGGGCGACTTGAAGGACCCGAGCAAGGCCATCCCCGCTGGCACGCTATGGGCTACATT
GACAACCCTTGTTGTCTACGCAATCGTCGTTCTTTCCCTGGCCGCCAGCACCACCCGCGAGTCGCTTCTCGCCAA
TAACAACGTCCTGTTTCTTACCAATATTTTCCCGCCCATCATTCTCGCGGGAGAGTGCTCTGTCACTTTCGTCTC
GGCTCTCATCTGCATGATGGGCTGTGCGAACCTGTTCCAGGCCCTCGCCAGAGACCGCGTCCTACCCGGCTTGTC
CGTCTTCGGCAAGGGCTCGAGGAAGAGCGATGTGGCCTTTACCGCCATCCTCTTGACTTATGCTCTGGTTCAGGT
CGCCTTGCTGGCAGATCTGAATCGCATTGCCGCCCTCATCTCCATGGGCTATCAGGTATCTTCCCCGGTTGTCAG
CGAACGTCCGGCGTGCCTGACCCATGCCAGATGACCTTTCTTGTCATGAATCTCGCCTGTTTCCTTCTCAAGATC
GGGTCGGCGCCCAACTTCCGCCCGGGCTTCAAGTTCTTTAGCTGGCAGACGGCGCTCGCTGGCAGCCTACTGTCG
GCCGCCGCCATGTTCTTCATACACGAGACCTACGCGGCCGTTGCCATCTGCCTCCTCTGCTTCCTCTTCCTGCTT
ATTCACTACCTCTGCCCGCCGAAGCGGTGGGGGGACGTCTCGCAGAACCTCATCTATCACCAGGTCAGAAAATAT
CTGCTGCGCCTGCGGCCCGAGCACATCAAGTTCTGGAGGCCTCACATTATTCTGCTCATCAACGACCCACGTCGT
CAAAACCGGTTGATTCAGTTCTGCAACTCGATGAAAAAGGGGTCTTTGTACATTCTTGGGCATGTCATCGTGACG
GAAGACTTCGACAGCGGCGTCGGCGAGGCCCGTCTCCAACAACAGGCCTGGAGCAATTACATATCCGAGTTTTCC
AGGATCAAGGCCTTTCTGCAGCTGACAATGTCTCCTTCCCTCGTTTGGGGCATCCGGAATCTGATACTATCGGCT
GGTTTGGGTGGCATGCGACCGAACATTGCCGTCTTGGGCTTCTACAATATGGACGACCTCCGCCGGTCTAAGCCC
ATGATCCCAATACCCGATCTTCCTGCGGCCTCGTCCAAGCCGCGACGGCCGTTTTGGGCCGACGGCAAGGCCCCT
GTGCGACGGAGAGAGGACTCGTCATCTCGTCTATTGACAGGGTCCTTACCGACTGACGTGATCCGGACCGAGGGC
CCTATGTCTCCGACGGATTATATGCTCGTGTTGGAGGACCTGGCACTCAAATATCGCCTCAACGTCGCTGTGGCG
TACGGGTTCGAGTCGCTGGAGACACCGCGAGATGATGGTGCCAACACGAAGAAGTACATCGATCTGTGGCCTATA
CAGATGTCCGCCGAGGTTGCCGCCGATGGCAAGAATGTCTTGACGACAAACTTTGACACTTGTACGTGCCGGTTT
CTGTTTTTGTCGCCTGTTGAGGATACGCGGCTCATATTCTTGACCAGACACTCTCATACTTCAGCTGGGCCACAT
ACTACGGAGCGTACGCGACTGGCGACGTGTCTACTCGCTTCGCGTCATGGTCTTTGTGGAATACGAAAGTGAGGT
GGACGAAGAGTCGGCGCGGTTGAAGGCGCTGCTGGAAAAGCTGCGGATCGAAGCCGAGGTTCTCGTTTTCTGGCT
TGCAGCCGGACAGTTGGGCACGTACGAACTCATCGTTAACGGTAGAACCGGTGATGGCGGGGCCGAGAAGATGGT
CGACGACGCACTACGGCACGAGGAATGGTGGGACGACCTGCAGACGTACCGCGGACAGGCTGGCGAGGCCGGACT
GAATCGAGAGGCACATCAGTTGGTGCTATCCCTCGACGCTGCGGCTGGACGAGCGGCCGTTTTCGACGAGGGCGT
CGGCAGTCGACGGCGTCATAGCGTGACGGAAGTTGATGGGATGCCGAGGAATCCCGACATTGGCCTTTTGAACAA
ATGGGGAGTCAACGTGGGCATACACACTCATCGCCTTCCTGAAAACGTTCTTCGCCAGCCGGAGATGGACGACGC
CCTGCGGACCATTACCGAATGTTCTGACTCGGATGAAGAGTACGGTTTCGCTTCAGAGCATGTCGTCACGGCCAA
GCCCTTGAGCCCGGTGAGACGACCATTGCTCAGGGCCTCTGGGCAATCAGCTCCGGGCCCGTCGAGCCATCGCGA
AGTCGGACACGGACGCTGGCCTGAGGACACGGACGGAACCCTGTCGTCGCACACGGCTGCCTTTGAGGGCATTCC
CAAGCTTGTAGAGACAACGGCCAGTCCGTCGCCTACGCGCGAAGAGGGCTCTCGCATGGCCATGGGATCATCTCC
AGCCCGTCACGCGCCGGTTCCGGTGCCCTCAGCCGTCTCCCTCGATGCAAACGATCGGTCGCGATCCCAGAGCCC
GACGAGCGGCTTGAGCGCTCGGGCACTGGGGGAGGCACCCGTTACGCCCATGCGACCCAGCTTCTCCCGACAGTC
TTCGGCCTCACGTTTCTCCTCTCGACCGGTTCCTGAGACGAGAGTCGTGGCGGAAGCTGAGGGGCCCACGCTTAG
CTTCGCGCCCATGGACTCGACACCGGCGTCGCAGAGGGTCGAGCGGCCCGCCCATTCGAGGCAGTCTTCTTGGAG
CAAGCCTTTCAGCAGGGTGTCCAAGGCTGATGTCGCAGGAGAGTCTCAAGCGCGCGGGGCTCCTCGTCCGCCTCT
GCCGCGACAACATTCGCGACACGGTTCGCAGCACTCTTATTTTGGGGCCCAAGGTGTGAGCTTGAGCATGCCCGA
CCTGTGCGACTCGTACTTCAGAAACTCGGCCGACGCTAACCACGCAGACGGCTCGTCGTACTCGACGCAGAGCGT
GGCGCTGTCGTTCAACGACCTCCCCAGCCGGGCCCAGCATCTGATTCTCAATGAGCTGATGCGTCAGCACTCGAC
GGACACGGCTGTTCTCATGAGCACGTTGCCCATACCCAGCGAAGGGACGAGTCTGGACGAGGCGGCGACGATTCG
ATATCTCTCTGATGTGGAGATTTTGTGTCATGGGCTGCCGCCGACGATGATGGTTTTGAGCAATAACATGACGGT
TACGGTGAGCCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail