Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2349
Gene name
Locationscaffold_2:48007..50050
Strand+
Gene length (bp)2043
Transcript length (bp)2043
Coding sequence length (bp)2040
Protein length (aa) 680

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.02 0.00 0.16
CcL In ants, during behavior modification 5.49 1.31 9.67
CcD In ants, recently dead 1.65 0.31 3.00

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.203598 no
SC16a CcD 0.203598 no
CcL CcD 0.002236 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2349
MKVTALVSSLLAAGASGATLREGRQLPAELQSEIDAQKQQLENGLAEIDWEHPPMKSVAVENPATCDNGAWLGRC
RNLASDHIRYPFPGENLEASKPRLYHVLVKRLGSNSTNPVTKTVFYKRQVQGSIEYNHGPDDAYHSSEKSSSDTK
TTSNEWREDNSLSSGWNAGAAYSAGISLGFFGAQTQLHAGYHSDKASSEGKSGSESALTSKSGSNFEGRNCKAGH
ACSTELFAWFVRYSGYCKVLPVVHCGSKFDDGKSNVDMCVTPEEEMCKSHLPFRTQHCQTDNAERPYKYVPCEIE
QHIVLPGSRPLIEDHYVSYPLPRTDDHDIVEYKAGCYNLVIDYCFSPVRSEKQYWSKTKGRWENRPGAPPNITAF
EHPLPVIMGLSLEGDIQGYELDTEEVYNPENSPKPYYSRWLQRWYDRPGPLPNVEVYEAQLRREQDELRAEEEAQ
LRREEKLRRAQARRNRRQKRPIKQYRQRTTDNRSGRHSVDNRGSAGGTFIGQQNGHYYGRGVTYIGSDRRGSGGA
ASSYRDARGANSHRYAHSASRGAFVNVNGGGSRGNVGQSSSEYYGGDVGSIGNTGYNRGGGGVRKDYHGYDEDRG
QSQDGNPAPLDEEYGAIGVRDQDRALDDGLVRNRGTYDSGNQPSPRVFDRPKLDDGSEVEASQPRLSFVDDGRGE
ELMLG
Coding >Ophio5|2349
ATGAAGGTGACGGCTCTCGTTTCCAGCCTGCTGGCTGCAGGCGCATCCGGCGCCACATTGCGCGAAGGCCGCCAA
CTCCCAGCCGAACTGCAGTCCGAGATTGATGCTCAGAAGCAGCAGCTGGAGAATGGCCTAGCCGAGATAGACTGG
GAGCATCCCCCGATGAAGTCGGTGGCGGTGGAGAACCCGGCGACGTGCGACAACGGGGCCTGGCTTGGTCGTTGC
CGCAATCTCGCCTCGGACCACATTCGCTATCCGTTCCCTGGAGAGAATCTGGAGGCATCGAAGCCGAGACTTTAC
CACGTTCTAGTAAAGAGATTGGGCTCCAATTCTACCAATCCCGTCACCAAGACCGTCTTTTACAAACGTCAAGTA
CAAGGCAGCATCGAATACAACCATGGCCCAGACGACGCATACCACAGCTCCGAAAAGTCTTCGTCCGATACCAAG
ACGACGTCCAACGAATGGAGGGAGGACAATAGTCTCTCCAGCGGCTGGAACGCCGGCGCCGCTTACAGTGCCGGG
ATTAGTTTGGGTTTCTTCGGTGCCCAAACGCAGCTTCATGCCGGATATCACAGCGACAAGGCCTCGTCGGAGGGC
AAGTCTGGATCCGAGTCGGCCTTGACGAGTAAATCCGGGTCCAACTTTGAGGGGAGAAACTGCAAGGCTGGACAC
GCCTGCTCGACCGAGCTCTTTGCTTGGTTCGTGAGATACTCCGGGTACTGCAAAGTCCTGCCCGTCGTTCACTGC
GGTTCTAAATTCGACGATGGCAAGTCCAACGTCGACATGTGCGTTACCCCAGAGGAAGAGATGTGTAAGAGTCAC
CTCCCTTTTCGGACACAACATTGCCAGACCGATAATGCCGAACGGCCTTACAAGTATGTGCCATGTGAGATTGAG
CAACACATTGTGCTCCCGGGGTCGAGACCCCTGATTGAAGACCACTACGTGTCCTACCCGTTGCCGAGGACAGAC
GACCATGATATCGTGGAATACAAAGCCGGCTGCTACAACCTAGTCATCGACTATTGTTTCTCACCTGTCCGAAGC
GAAAAGCAGTACTGGAGCAAGACAAAGGGGAGGTGGGAGAATAGGCCCGGAGCTCCTCCCAACATCACCGCCTTT
GAACACCCCCTACCTGTAATCATGGGACTCAGCCTAGAAGGCGACATTCAAGGTTACGAACTCGATACAGAAGAA
GTCTACAACCCAGAAAACTCACCAAAGCCGTACTACTCTCGATGGCTACAGCGCTGGTACGACCGACCGGGACCA
CTCCCGAATGTCGAAGTATACGAAGCCCAACTACGACGGGAACAAGACGAATTGCGAGCAGAAGAAGAAGCCCAA
CTTCGGCGGGAGGAGAAACTCCGACGAGCTCAAGCGCGACGAAACCGACGACAGAAAAGACCCATCAAGCAATAC
CGACAGCGCACCACCGACAACCGCAGCGGTCGCCACAGCGTCGACAACAGAGGTAGCGCGGGAGGCACCTTCATC
GGCCAGCAGAACGGACACTATTACGGCCGCGGCGTGACTTACATCGGCTCGGATCGGCGCGGCAGCGGAGGAGCA
GCCTCCTCGTATAGGGATGCCAGGGGCGCCAACAGCCACCGGTACGCTCACAGCGCTTCGCGAGGGGCCTTCGTC
AATGTCAATGGCGGAGGGAGTCGTGGGAATGTCGGACAGAGCTCTAGTGAGTACTACGGAGGTGATGTCGGCAGC
ATCGGTAACACGGGCTATAACCGAGGCGGAGGCGGCGTTCGCAAAGACTATCATGGCTACGACGAGGATAGAGGG
CAATCTCAGGACGGAAATCCTGCGCCGCTCGACGAAGAGTACGGGGCGATTGGGGTCCGGGACCAGGATCGGGCT
CTGGATGACGGCCTGGTCCGGAATCGAGGCACGTACGACAGTGGAAATCAGCCTTCTCCGCGCGTATTTGACCGT
CCAAAGCTCGACGATGGATCAGAAGTTGAAGCGTCACAGCCAAGACTTTCATTTGTCGATGACGGAAGGGGCGAA
GAGTTAATGCTGGGG
Transcript >Ophio5|2349
ATGAAGGTGACGGCTCTCGTTTCCAGCCTGCTGGCTGCAGGCGCATCCGGCGCCACATTGCGCGAAGGCCGCCAA
CTCCCAGCCGAACTGCAGTCCGAGATTGATGCTCAGAAGCAGCAGCTGGAGAATGGCCTAGCCGAGATAGACTGG
GAGCATCCCCCGATGAAGTCGGTGGCGGTGGAGAACCCGGCGACGTGCGACAACGGGGCCTGGCTTGGTCGTTGC
CGCAATCTCGCCTCGGACCACATTCGCTATCCGTTCCCTGGAGAGAATCTGGAGGCATCGAAGCCGAGACTTTAC
CACGTTCTAGTAAAGAGATTGGGCTCCAATTCTACCAATCCCGTCACCAAGACCGTCTTTTACAAACGTCAAGTA
CAAGGCAGCATCGAATACAACCATGGCCCAGACGACGCATACCACAGCTCCGAAAAGTCTTCGTCCGATACCAAG
ACGACGTCCAACGAATGGAGGGAGGACAATAGTCTCTCCAGCGGCTGGAACGCCGGCGCCGCTTACAGTGCCGGG
ATTAGTTTGGGTTTCTTCGGTGCCCAAACGCAGCTTCATGCCGGATATCACAGCGACAAGGCCTCGTCGGAGGGC
AAGTCTGGATCCGAGTCGGCCTTGACGAGTAAATCCGGGTCCAACTTTGAGGGGAGAAACTGCAAGGCTGGACAC
GCCTGCTCGACCGAGCTCTTTGCTTGGTTCGTGAGATACTCCGGGTACTGCAAAGTCCTGCCCGTCGTTCACTGC
GGTTCTAAATTCGACGATGGCAAGTCCAACGTCGACATGTGCGTTACCCCAGAGGAAGAGATGTGTAAGAGTCAC
CTCCCTTTTCGGACACAACATTGCCAGACCGATAATGCCGAACGGCCTTACAAGTATGTGCCATGTGAGATTGAG
CAACACATTGTGCTCCCGGGGTCGAGACCCCTGATTGAAGACCACTACGTGTCCTACCCGTTGCCGAGGACAGAC
GACCATGATATCGTGGAATACAAAGCCGGCTGCTACAACCTAGTCATCGACTATTGTTTCTCACCTGTCCGAAGC
GAAAAGCAGTACTGGAGCAAGACAAAGGGGAGGTGGGAGAATAGGCCCGGAGCTCCTCCCAACATCACCGCCTTT
GAACACCCCCTACCTGTAATCATGGGACTCAGCCTAGAAGGCGACATTCAAGGTTACGAACTCGATACAGAAGAA
GTCTACAACCCAGAAAACTCACCAAAGCCGTACTACTCTCGATGGCTACAGCGCTGGTACGACCGACCGGGACCA
CTCCCGAATGTCGAAGTATACGAAGCCCAACTACGACGGGAACAAGACGAATTGCGAGCAGAAGAAGAAGCCCAA
CTTCGGCGGGAGGAGAAACTCCGACGAGCTCAAGCGCGACGAAACCGACGACAGAAAAGACCCATCAAGCAATAC
CGACAGCGCACCACCGACAACCGCAGCGGTCGCCACAGCGTCGACAACAGAGGTAGCGCGGGAGGCACCTTCATC
GGCCAGCAGAACGGACACTATTACGGCCGCGGCGTGACTTACATCGGCTCGGATCGGCGCGGCAGCGGAGGAGCA
GCCTCCTCGTATAGGGATGCCAGGGGCGCCAACAGCCACCGGTACGCTCACAGCGCTTCGCGAGGGGCCTTCGTC
AATGTCAATGGCGGAGGGAGTCGTGGGAATGTCGGACAGAGCTCTAGTGAGTACTACGGAGGTGATGTCGGCAGC
ATCGGTAACACGGGCTATAACCGAGGCGGAGGCGGCGTTCGCAAAGACTATCATGGCTACGACGAGGATAGAGGG
CAATCTCAGGACGGAAATCCTGCGCCGCTCGACGAAGAGTACGGGGCGATTGGGGTCCGGGACCAGGATCGGGCT
CTGGATGACGGCCTGGTCCGGAATCGAGGCACGTACGACAGTGGAAATCAGCCTTCTCCGCGCGTATTTGACCGT
CCAAAGCTCGACGATGGATCAGAAGTTGAAGCGTCACAGCCAAGACTTTCATTTGTCGATGACGGAAGGGGCGAA
GAGTTAATGCTGGGGTAA
Gene >Ophio5|2349
ATGAAGGTGACGGCTCTCGTTTCCAGCCTGCTGGCTGCAGGCGCATCCGGCGCCACATTGCGCGAAGGCCGCCAA
CTCCCAGCCGAACTGCAGTCCGAGATTGATGCTCAGAAGCAGCAGCTGGAGAATGGCCTAGCCGAGATAGACTGG
GAGCATCCCCCGATGAAGTCGGTGGCGGTGGAGAACCCGGCGACGTGCGACAACGGGGCCTGGCTTGGTCGTTGC
CGCAATCTCGCCTCGGACCACATTCGCTATCCGTTCCCTGGAGAGAATCTGGAGGCATCGAAGCCGAGACTTTAC
CACGTTCTAGTAAAGAGATTGGGCTCCAATTCTACCAATCCCGTCACCAAGACCGTCTTTTACAAACGTCAAGTA
CAAGGCAGCATCGAATACAACCATGGCCCAGACGACGCATACCACAGCTCCGAAAAGTCTTCGTCCGATACCAAG
ACGACGTCCAACGAATGGAGGGAGGACAATAGTCTCTCCAGCGGCTGGAACGCCGGCGCCGCTTACAGTGCCGGG
ATTAGTTTGGGTTTCTTCGGTGCCCAAACGCAGCTTCATGCCGGATATCACAGCGACAAGGCCTCGTCGGAGGGC
AAGTCTGGATCCGAGTCGGCCTTGACGAGTAAATCCGGGTCCAACTTTGAGGGGAGAAACTGCAAGGCTGGACAC
GCCTGCTCGACCGAGCTCTTTGCTTGGTTCGTGAGATACTCCGGGTACTGCAAAGTCCTGCCCGTCGTTCACTGC
GGTTCTAAATTCGACGATGGCAAGTCCAACGTCGACATGTGCGTTACCCCAGAGGAAGAGATGTGTAAGAGTCAC
CTCCCTTTTCGGACACAACATTGCCAGACCGATAATGCCGAACGGCCTTACAAGTATGTGCCATGTGAGATTGAG
CAACACATTGTGCTCCCGGGGTCGAGACCCCTGATTGAAGACCACTACGTGTCCTACCCGTTGCCGAGGACAGAC
GACCATGATATCGTGGAATACAAAGCCGGCTGCTACAACCTAGTCATCGACTATTGTTTCTCACCTGTCCGAAGC
GAAAAGCAGTACTGGAGCAAGACAAAGGGGAGGTGGGAGAATAGGCCCGGAGCTCCTCCCAACATCACCGCCTTT
GAACACCCCCTACCTGTAATCATGGGACTCAGCCTAGAAGGCGACATTCAAGGTTACGAACTCGATACAGAAGAA
GTCTACAACCCAGAAAACTCACCAAAGCCGTACTACTCTCGATGGCTACAGCGCTGGTACGACCGACCGGGACCA
CTCCCGAATGTCGAAGTATACGAAGCCCAACTACGACGGGAACAAGACGAATTGCGAGCAGAAGAAGAAGCCCAA
CTTCGGCGGGAGGAGAAACTCCGACGAGCTCAAGCGCGACGAAACCGACGACAGAAAAGACCCATCAAGCAATAC
CGACAGCGCACCACCGACAACCGCAGCGGTCGCCACAGCGTCGACAACAGAGGTAGCGCGGGAGGCACCTTCATC
GGCCAGCAGAACGGACACTATTACGGCCGCGGCGTGACTTACATCGGCTCGGATCGGCGCGGCAGCGGAGGAGCA
GCCTCCTCGTATAGGGATGCCAGGGGCGCCAACAGCCACCGGTACGCTCACAGCGCTTCGCGAGGGGCCTTCGTC
AATGTCAATGGCGGAGGGAGTCGTGGGAATGTCGGACAGAGCTCTAGTGAGTACTACGGAGGTGATGTCGGCAGC
ATCGGTAACACGGGCTATAACCGAGGCGGAGGCGGCGTTCGCAAAGACTATCATGGCTACGACGAGGATAGAGGG
CAATCTCAGGACGGAAATCCTGCGCCGCTCGACGAAGAGTACGGGGCGATTGGGGTCCGGGACCAGGATCGGGCT
CTGGATGACGGCCTGGTCCGGAATCGAGGCACGTACGACAGTGGAAATCAGCCTTCTCCGCGCGTATTTGACCGT
CCAAAGCTCGACGATGGATCAGAAGTTGAAGCGTCACAGCCAAGACTTTCATTTGTCGATGACGGAAGGGGCGAA
GAGTTAATGCTGGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail