Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2341
Gene name
Locationscaffold_2:24848..25301
Strand-
Gene length (bp)453
Transcript length (bp)453
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 3.75 0.00 7.68
CcL In ants, during behavior modification 15.34 2.65 28.03
CcD In ants, recently dead 22.12 6.07 38.17

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.005848 yes
SC16a CcD 0.000770 yes
CcL CcD 0.367037 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2341
MYAHGAVQGFLLAFGLLLAPQMSLASPMPIDLSGVRKSHNARGGNSNGATVTGGNDTFASRGNGGAWPFPAPNRA
NPLPADLQATRNFRGLLNRTPDNEAIREAIRNQAPILNALRGGGGRSGDSRNQPRSDPSYQIPPMLEEIGQQEAE
Coding >Ophio5|2341
ATGTACGCTCACGGCGCCGTTCAAGGCTTCCTCTTGGCCTTTGGTCTTCTTCTCGCCCCTCAGATGAGCCTTGCG
AGCCCGATGCCGATTGATCTAAGCGGAGTCCGGAAATCGCACAATGCCAGAGGCGGCAACAGTAACGGCGCTACA
GTCACTGGCGGGAATGACACTTTCGCCAGTCGCGGCAACGGAGGCGCATGGCCTTTCCCTGCCCCTAACCGCGCG
AATCCTCTGCCTGCCGACCTTCAGGCCACGAGAAACTTCCGGGGCCTTCTCAATCGCACCCCGGACAATGAAGCT
ATACGAGAGGCCATTCGGAATCAGGCTCCAATTTTGAACGCACTTCGGGGTGGTGGTGGACGCTCTGGGGATAGC
AGGAATCAGCCTCGTTCTGATCCGTCTTATCAGATTCCGCCAATGTTGGAAGAGATAGGGCAGCAGGAAGCTGAA
Transcript >Ophio5|2341
ATGTACGCTCACGGCGCCGTTCAAGGCTTCCTCTTGGCCTTTGGTCTTCTTCTCGCCCCTCAGATGAGCCTTGCG
AGCCCGATGCCGATTGATCTAAGCGGAGTCCGGAAATCGCACAATGCCAGAGGCGGCAACAGTAACGGCGCTACA
GTCACTGGCGGGAATGACACTTTCGCCAGTCGCGGCAACGGAGGCGCATGGCCTTTCCCTGCCCCTAACCGCGCG
AATCCTCTGCCTGCCGACCTTCAGGCCACGAGAAACTTCCGGGGCCTTCTCAATCGCACCCCGGACAATGAAGCT
ATACGAGAGGCCATTCGGAATCAGGCTCCAATTTTGAACGCACTTCGGGGTGGTGGTGGACGCTCTGGGGATAGC
AGGAATCAGCCTCGTTCTGATCCGTCTTATCAGATTCCGCCAATGTTGGAAGAGATAGGGCAGCAGGAAGCTGAA
TAA
Gene >Ophio5|2341
ATGTACGCTCACGGCGCCGTTCAAGGCTTCCTCTTGGCCTTTGGTCTTCTTCTCGCCCCTCAGATGAGCCTTGCG
AGCCCGATGCCGATTGATCTAAGCGGAGTCCGGAAATCGCACAATGCCAGAGGCGGCAACAGTAACGGCGCTACA
GTCACTGGCGGGAATGACACTTTCGCCAGTCGCGGCAACGGAGGCGCATGGCCTTTCCCTGCCCCTAACCGCGCG
AATCCTCTGCCTGCCGACCTTCAGGCCACGAGAAACTTCCGGGGCCTTCTCAATCGCACCCCGGACAATGAAGCT
ATACGAGAGGCCATTCGGAATCAGGCTCCAATTTTGAACGCACTTCGGGGTGGTGGTGGACGCTCTGGGGATAGC
AGGAATCAGCCTCGTTCTGATCCGTCTTATCAGATTCCGCCAATGTTGGAAGAGATAGGGCAGCAGGAAGCTGAA
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail