Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2340
Gene name
Locationscaffold_2:21093..22554
Strand-
Gene length (bp)1461
Transcript length (bp)1461
Coding sequence length (bp)1458
Protein length (aa) 486

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 201 463 3.0E-12
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 178 455 2.0E-11
sp|A6QL92|S35F5_BOVIN Solute carrier family 35 member F5 OS=Bos taurus GN=SLC35F5 PE=2 SV=1 268 450 4.0E-08
sp|Q5R6J3|S35F5_PONAB Solute carrier family 35 member F5 OS=Pongo abelii GN=SLC35F5 PE=2 SV=1 226 450 5.0E-07
sp|Q4R794|S35F5_MACFA Solute carrier family 35 member F5 OS=Macaca fascicularis GN=SLC35F5 PE=2 SV=1 226 450 6.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03730|YMB8_YEAST Uncharacterized vacuolar membrane protein YML018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YML018C PE=1 SV=1 201 463 3.0E-12
sp|O94654|YGF3_SCHPO Uncharacterized transporter C405.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC405.03c PE=3 SV=1 178 455 2.0E-11
sp|A6QL92|S35F5_BOVIN Solute carrier family 35 member F5 OS=Bos taurus GN=SLC35F5 PE=2 SV=1 268 450 4.0E-08
sp|Q5R6J3|S35F5_PONAB Solute carrier family 35 member F5 OS=Pongo abelii GN=SLC35F5 PE=2 SV=1 226 450 5.0E-07
sp|Q4R794|S35F5_MACFA Solute carrier family 35 member F5 OS=Macaca fascicularis GN=SLC35F5 PE=2 SV=1 226 450 6.0E-07
sp|Q8WV83|S35F5_HUMAN Solute carrier family 35 member F5 OS=Homo sapiens GN=SLC35F5 PE=2 SV=1 226 450 8.0E-07
sp|Q8R314|S35F5_MOUSE Solute carrier family 35 member F5 OS=Mus musculus GN=Slc35f5 PE=2 SV=1 226 450 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 109 127 18
2 142 164 22
3 211 233 22
4 243 262 19
5 271 290 19
6 305 324 19
7 344 366 22
8 381 403 22
9 408 430 22
10 435 457 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2340
MNAGDSGANKARTDDFPATAAAASPDRHAENGDLAGVPLLHKPETTAANGDAGRSLLWSSDDYDADAEPGLDQDH
DESRPPPFSRRSTMRSRSPLAAAAQAQAATRKKYTYAAFFLVISLVTFAIQTELSAHIQHDLGWDKAYCMMYFTH
GSWIVLWPAMLLVLRLQKRDEPWPVFWRRHKQLLASTVAMIELQTLDVFSSSAQRRARPALYLIRTTAFITSALT
VAGLSWYVAVSLTTPSDLTAIYNCSAFFAYVFSVPILREPLRLDKSVAVFIAIVGVLIVAYGDTGESPGKGHQPG
AGSRFVGNLVIGIGSVLYGLYEVLYKRYACPPEGVSPGRGTIFANTFGACIGLFTLTVLWIPLPVLHVLGIEKFE
MPEASTAWLILVAVLANATFSGSFLVLISLTSPVLSSVAALLTIFIVALADWFLTGQPLSWAAIIGGSMIIVAFL
GLSWSTYREMTEHEARKLAVDLTDSDEDGDRAAGEY
Coding >Ophio5|2340
ATGAACGCCGGCGATAGCGGAGCCAACAAGGCCCGCACCGATGATTTCCCTGCCACCGCCGCCGCCGCCTCGCCC
GATCGTCATGCGGAAAATGGCGACCTCGCCGGCGTGCCGTTACTTCACAAACCCGAAACGACGGCAGCCAACGGA
GACGCTGGTCGGAGTCTCCTCTGGTCAAGCGACGATTATGATGCCGATGCCGAACCGGGACTCGACCAAGACCAT
GACGAGTCTCGACCTCCGCCCTTCAGCCGTCGCTCGACGATGCGAAGTCGAAGTCCGCTCGCTGCCGCTGCCCAG
GCTCAGGCTGCGACGCGCAAAAAATACACGTACGCAGCCTTCTTCCTGGTCATCAGCCTCGTCACTTTCGCCATC
CAGACGGAGCTGAGCGCCCACATCCAGCACGACCTCGGCTGGGACAAGGCTTATTGCATGATGTACTTTACCCAC
GGCTCTTGGATCGTTCTGTGGCCTGCCATGCTGTTGGTTTTGCGTCTGCAGAAGCGTGACGAGCCGTGGCCCGTC
TTTTGGCGTCGACACAAGCAACTGCTGGCTTCGACTGTGGCTATGATCGAGTTGCAGACGCTCGATGTCTTTTCC
TCGTCGGCTCAGCGTCGTGCCCGACCGGCTCTCTATCTGATTCGGACGACGGCCTTCATCACCTCGGCCTTGACT
GTCGCCGGTTTGAGCTGGTATGTGGCCGTCAGCCTGACGACGCCTTCGGATCTGACGGCCATCTACAATTGCTCC
GCCTTTTTTGCTTACGTCTTCTCTGTGCCTATCCTGCGCGAGCCTCTGCGCCTTGACAAGTCGGTTGCCGTCTTC
ATCGCCATCGTCGGCGTCCTGATTGTCGCCTATGGCGACACGGGCGAGTCTCCCGGAAAGGGTCATCAGCCGGGA
GCCGGCAGCCGCTTCGTCGGCAACCTCGTCATTGGCATCGGTTCCGTCCTCTACGGCCTGTACGAGGTGCTCTAC
AAGCGCTACGCTTGTCCTCCCGAAGGCGTCTCTCCTGGTCGGGGCACCATCTTTGCCAACACCTTTGGCGCTTGC
ATTGGCCTCTTCACCCTTACTGTTCTCTGGATCCCGCTGCCCGTCCTTCACGTGCTGGGCATTGAGAAGTTTGAG
ATGCCCGAAGCCTCGACTGCTTGGCTCATTCTCGTGGCCGTGCTGGCCAACGCCACATTTAGTGGCTCGTTTCTG
GTCCTCATCTCGCTGACGTCGCCGGTTCTATCGTCAGTCGCTGCTCTCCTCACCATCTTCATCGTCGCACTCGCC
GATTGGTTCCTGACGGGCCAACCCCTGAGCTGGGCTGCCATTATCGGTGGCTCCATGATCATCGTCGCTTTCCTC
GGTCTCAGTTGGAGCACATATCGCGAGATGACAGAGCATGAGGCCCGCAAGCTCGCCGTCGATCTGACGGATAGT
GACGAGGATGGCGATCGGGCGGCTGGCGAGTAT
Transcript >Ophio5|2340
ATGAACGCCGGCGATAGCGGAGCCAACAAGGCCCGCACCGATGATTTCCCTGCCACCGCCGCCGCCGCCTCGCCC
GATCGTCATGCGGAAAATGGCGACCTCGCCGGCGTGCCGTTACTTCACAAACCCGAAACGACGGCAGCCAACGGA
GACGCTGGTCGGAGTCTCCTCTGGTCAAGCGACGATTATGATGCCGATGCCGAACCGGGACTCGACCAAGACCAT
GACGAGTCTCGACCTCCGCCCTTCAGCCGTCGCTCGACGATGCGAAGTCGAAGTCCGCTCGCTGCCGCTGCCCAG
GCTCAGGCTGCGACGCGCAAAAAATACACGTACGCAGCCTTCTTCCTGGTCATCAGCCTCGTCACTTTCGCCATC
CAGACGGAGCTGAGCGCCCACATCCAGCACGACCTCGGCTGGGACAAGGCTTATTGCATGATGTACTTTACCCAC
GGCTCTTGGATCGTTCTGTGGCCTGCCATGCTGTTGGTTTTGCGTCTGCAGAAGCGTGACGAGCCGTGGCCCGTC
TTTTGGCGTCGACACAAGCAACTGCTGGCTTCGACTGTGGCTATGATCGAGTTGCAGACGCTCGATGTCTTTTCC
TCGTCGGCTCAGCGTCGTGCCCGACCGGCTCTCTATCTGATTCGGACGACGGCCTTCATCACCTCGGCCTTGACT
GTCGCCGGTTTGAGCTGGTATGTGGCCGTCAGCCTGACGACGCCTTCGGATCTGACGGCCATCTACAATTGCTCC
GCCTTTTTTGCTTACGTCTTCTCTGTGCCTATCCTGCGCGAGCCTCTGCGCCTTGACAAGTCGGTTGCCGTCTTC
ATCGCCATCGTCGGCGTCCTGATTGTCGCCTATGGCGACACGGGCGAGTCTCCCGGAAAGGGTCATCAGCCGGGA
GCCGGCAGCCGCTTCGTCGGCAACCTCGTCATTGGCATCGGTTCCGTCCTCTACGGCCTGTACGAGGTGCTCTAC
AAGCGCTACGCTTGTCCTCCCGAAGGCGTCTCTCCTGGTCGGGGCACCATCTTTGCCAACACCTTTGGCGCTTGC
ATTGGCCTCTTCACCCTTACTGTTCTCTGGATCCCGCTGCCCGTCCTTCACGTGCTGGGCATTGAGAAGTTTGAG
ATGCCCGAAGCCTCGACTGCTTGGCTCATTCTCGTGGCCGTGCTGGCCAACGCCACATTTAGTGGCTCGTTTCTG
GTCCTCATCTCGCTGACGTCGCCGGTTCTATCGTCAGTCGCTGCTCTCCTCACCATCTTCATCGTCGCACTCGCC
GATTGGTTCCTGACGGGCCAACCCCTGAGCTGGGCTGCCATTATCGGTGGCTCCATGATCATCGTCGCTTTCCTC
GGTCTCAGTTGGAGCACATATCGCGAGATGACAGAGCATGAGGCCCGCAAGCTCGCCGTCGATCTGACGGATAGT
GACGAGGATGGCGATCGGGCGGCTGGCGAGTATTAG
Gene >Ophio5|2340
ATGAACGCCGGCGATAGCGGAGCCAACAAGGCCCGCACCGATGATTTCCCTGCCACCGCCGCCGCCGCCTCGCCC
GATCGTCATGCGGAAAATGGCGACCTCGCCGGCGTGCCGTTACTTCACAAACCCGAAACGACGGCAGCCAACGGA
GACGCTGGTCGGAGTCTCCTCTGGTCAAGCGACGATTATGATGCCGATGCCGAACCGGGACTCGACCAAGACCAT
GACGAGTCTCGACCTCCGCCCTTCAGCCGTCGCTCGACGATGCGAAGTCGAAGTCCGCTCGCTGCCGCTGCCCAG
GCTCAGGCTGCGACGCGCAAAAAATACACGTACGCAGCCTTCTTCCTGGTCATCAGCCTCGTCACTTTCGCCATC
CAGACGGAGCTGAGCGCCCACATCCAGCACGACCTCGGCTGGGACAAGGCTTATTGCATGATGTACTTTACCCAC
GGCTCTTGGATCGTTCTGTGGCCTGCCATGCTGTTGGTTTTGCGTCTGCAGAAGCGTGACGAGCCGTGGCCCGTC
TTTTGGCGTCGACACAAGCAACTGCTGGCTTCGACTGTGGCTATGATCGAGTTGCAGACGCTCGATGTCTTTTCC
TCGTCGGCTCAGCGTCGTGCCCGACCGGCTCTCTATCTGATTCGGACGACGGCCTTCATCACCTCGGCCTTGACT
GTCGCCGGTTTGAGCTGGTATGTGGCCGTCAGCCTGACGACGCCTTCGGATCTGACGGCCATCTACAATTGCTCC
GCCTTTTTTGCTTACGTCTTCTCTGTGCCTATCCTGCGCGAGCCTCTGCGCCTTGACAAGTCGGTTGCCGTCTTC
ATCGCCATCGTCGGCGTCCTGATTGTCGCCTATGGCGACACGGGCGAGTCTCCCGGAAAGGGTCATCAGCCGGGA
GCCGGCAGCCGCTTCGTCGGCAACCTCGTCATTGGCATCGGTTCCGTCCTCTACGGCCTGTACGAGGTGCTCTAC
AAGCGCTACGCTTGTCCTCCCGAAGGCGTCTCTCCTGGTCGGGGCACCATCTTTGCCAACACCTTTGGCGCTTGC
ATTGGCCTCTTCACCCTTACTGTTCTCTGGATCCCGCTGCCCGTCCTTCACGTGCTGGGCATTGAGAAGTTTGAG
ATGCCCGAAGCCTCGACTGCTTGGCTCATTCTCGTGGCCGTGCTGGCCAACGCCACATTTAGTGGCTCGTTTCTG
GTCCTCATCTCGCTGACGTCGCCGGTTCTATCGTCAGTCGCTGCTCTCCTCACCATCTTCATCGTCGCACTCGCC
GATTGGTTCCTGACGGGCCAACCCCTGAGCTGGGCTGCCATTATCGGTGGCTCCATGATCATCGTCGCTTTCCTC
GGTCTCAGTTGGAGCACATATCGCGAGATGACAGAGCATGAGGCCCGCAAGCTCGCCGTCGATCTGACGGATAGT
GACGAGGATGGCGATCGGGCGGCTGGCGAGTATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail