Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2334
Gene name
Locationscaffold_199:26813..31611
Strand-
Gene length (bp)4798
Transcript length (bp)4641
Coding sequence length (bp)4638
Protein length (aa) 1546

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 1.8E-74 1104 1353
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 1.2E-18 108 158
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.2E-12 751 833
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 2.3E-07 620 986

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 21 1374 0.0E+00
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 10 1374 0.0E+00
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 75 1361 0.0E+00
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 48 1362 0.0E+00
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 350 1361 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 21 1374 0.0E+00
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 10 1374 0.0E+00
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 75 1361 0.0E+00
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 48 1362 0.0E+00
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 350 1361 0.0E+00
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 345 1360 0.0E+00
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 343 1364 0.0E+00
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 345 1360 0.0E+00
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 296 1364 0.0E+00
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 343 1364 0.0E+00
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 318 1364 0.0E+00
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 326 1364 0.0E+00
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 343 1357 0.0E+00
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 345 1353 0.0E+00
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 350 1363 0.0E+00
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 350 1343 0.0E+00
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 341 1370 0.0E+00
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 343 1361 0.0E+00
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 345 1353 0.0E+00
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 345 1353 0.0E+00
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 350 1363 0.0E+00
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 350 1383 0.0E+00
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 327 1366 0.0E+00
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 349 1343 0.0E+00
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 327 1361 0.0E+00
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 350 1343 0.0E+00
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 327 1361 0.0E+00
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 350 1357 0.0E+00
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 326 1368 0.0E+00
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 342 1307 0.0E+00
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 342 1293 6.0E-179
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 351 1339 2.0E-173
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 350 1353 5.0E-167
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 351 1339 1.0E-165
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 341 1353 3.0E-161
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 341 1353 3.0E-159
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 341 1350 1.0E-147
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 341 1350 8.0E-142
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 706 1364 3.0E-133
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 727 1363 5.0E-133
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 750 1361 6.0E-133
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 748 1348 6.0E-132
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 740 1395 7.0E-130
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 740 1425 3.0E-128
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 749 1350 3.0E-126
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 352 1353 1.0E-101
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 352 1353 2.0E-100
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 353 1353 4.0E-99
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 353 1353 2.0E-98
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 353 1353 4.0E-98
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 353 1353 4.0E-97
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 353 1353 5.0E-97
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 351 1353 3.0E-96
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 351 1353 8.0E-95
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 728 1367 1.0E-92
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 813 1363 4.0E-77
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 819 1374 1.0E-72
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 351 896 3.0E-66
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 294 647 8.0E-63
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 350 650 1.0E-62
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 294 647 5.0E-62
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 341 649 8.0E-59
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 341 649 8.0E-58
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 331 665 3.0E-57
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 350 647 2.0E-45
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 351 655 3.0E-33
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 107 193 2.0E-18
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 795 1186 3.0E-18
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 109 207 7.0E-18
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 728 837 1.0E-17
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 110 193 4.0E-17
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 108 193 1.0E-15
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 47 228 2.0E-14
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 108 201 2.0E-14
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 108 201 3.0E-14
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 55 193 6.0E-14
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 76 197 8.0E-14
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 110 228 1.0E-13
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 76 197 1.0E-13
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 784 1104 1.0E-13
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 110 207 8.0E-13
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 47 209 9.0E-13
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 47 209 1.0E-12
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 800 1180 1.0E-12
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 800 979 1.0E-12
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 110 196 2.0E-12
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 788 977 3.0E-12
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 707 1104 3.0E-12
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 800 979 4.0E-12
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 788 977 5.0E-12
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 76 212 6.0E-12
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 88 198 1.0E-11
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 105 208 1.0E-11
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 614 958 1.0E-11
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 110 207 2.0E-11
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 88 208 2.0E-11
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 800 977 2.0E-11
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 800 977 2.0E-11
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 800 979 4.0E-11
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 800 977 6.0E-11
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 87 212 7.0E-11
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 110 198 7.0E-11
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 785 977 7.0E-11
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 108 207 9.0E-11
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 794 1104 9.0E-11
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 105 219 1.0E-10
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 110 198 1.0E-10
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 756 1180 1.0E-10
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 76 212 2.0E-10
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 72 207 2.0E-10
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 75 207 2.0E-10
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 97 207 3.0E-10
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 794 1100 3.0E-10
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 113 196 4.0E-10
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 800 1180 4.0E-10
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 800 986 5.0E-10
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 800 1180 5.0E-10
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 756 1180 6.0E-10
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 108 207 9.0E-10
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 794 971 9.0E-10
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 113 207 1.0E-09
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 113 222 1.0E-09
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 108 199 1.0E-09
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 103 209 1.0E-09
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 800 1180 1.0E-09
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 800 1180 1.0E-09
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 88 207 2.0E-09
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 108 202 3.0E-09
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 110 207 7.0E-09
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 731 1104 7.0E-09
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 800 979 9.0E-09
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 110 207 2.0E-08
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 104 212 2.0E-08
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 104 212 2.0E-08
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 800 979 3.0E-08
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 780 954 3.0E-08
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 757 973 4.0E-08
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 800 958 4.0E-08
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 794 1104 4.0E-08
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 353 959 4.0E-08
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 795 1104 4.0E-08
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 794 1100 6.0E-08
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 614 958 6.0E-08
sp|P39986|ATC6_YEAST Manganese-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPF1 PE=1 SV=1 764 1140 8.0E-08
sp|O14022|CTA5_SCHPO Cation-transporting ATPase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta5 PE=3 SV=1 787 1104 1.0E-07
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 788 955 3.0E-07
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 104 212 4.0E-07
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 110 207 9.0E-07
sp|Q9LT02|PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana GN=PDR2 PE=1 SV=1 787 1095 9.0E-07
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 800 955 9.0E-07
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 110 207 2.0E-06
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 800 958 2.0E-06
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 800 958 2.0E-06
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 110 209 3.0E-06
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 78 201 5.0E-06
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 41 193 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 140 174 34
2 511 533 22
3 557 579 22
4 1139 1156 17
5 1166 1188 22
6 1218 1240 22
7 1260 1277 17
8 1284 1306 22
9 1326 1344 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 42.90 22.33 63.46
CcL In ants, during behavior modification 43.95 22.48 65.43
CcD In ants, recently dead 33.97 18.15 49.79

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.933098 no
SC16a CcD 0.349318 no
CcL CcD 0.292234 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2334
MTTANGSGPGADGNPPKIERPHRTRWATRKMTIKSGRSKRLSLLNRMQQRKRASNEKPSAGDTSEPPLTDRSSED
GSDTSSQSEDNGRTLYFNLPLPDDLLSDGHPIQTFPRNKIRTAKYTPLSFVPKNLWFQFHNVANIFFLFLVILGI
FPIFGGVNPGLNAVPLIFIIVVTAIKDAVEDYRRTVLDNELNNAPVHRLSHWNNVNVEEGTVSSWRRFKKANTRL
FGSMWHAIESLWSQKARTARAERKARKLQEADPEDEVRPSVETTRTRMSVREALSSPFSHESFKSADDDIPMTPV
GSPKAVGDLPTLELPDDQDAKRAASLRSMKSDLVNYRRAPEGAKFKKDTWKSIQVGDFVRIYNDDELPADVIILS
TSDPDGACYVETKNLDGETNLKVRQALRCGRTLKHARDCERAEFHIQSEPPQPNLYKYNGAIHWKQRVPGCPEDE
PANMTEPITIDNLLLRGCNLRNTEWVLGVVIFTGHDTKIMMNAGITPSKRSRIAREMNFNVVCNFGILLIMCLLS
GIFNGVAWSKTDASLHFFDFGSIGGSAAMSGFITFWAAIIVFQNLVPISLYITLEIVRTLQAVLIFSDIDMYYAK
IDQPCIPKSWNISDDVGQIEYIFSDKTGTLTQNVMEFKKASINGQPYGEAFTEAQAGMQKRLGVDVVAEAARIET
EIAEAKVKALAGLRKLYDNPYLHDGSVTFIAPDFVSDLAGLGGPQQQAANEEFMLALSLCHTVIAERSPGDPPSM
NFKAQSPDEEALVATARDMGFTVISNNSDGIDLNVLGQDRHYPILNTIEFNSSRKRMSSIVRMPDGQIVLYCKGA
DSVIYSRLKRGEQQQLRRQTAEQLEMFAREGLRTLCIARKTLTEKEYEMWKKEHDAAASALENREEKLETVAELI
EQDLMLLGGTAIEDRLQDGVPDTIALLGQAGMKLWVLTGDKVETAINIGFSCNLLNNDMELIHLKLDEDETGETS
DETFLGTTEKLLEQNLQMFDLVGDDSDLAAARKNHEPPAPTHGLVIDGFTLRWALNDRLRQKFLLLCKQCKSVLC
CRVSPAQKAAVVAMVKTGLDVMTLSIGDGANDVAMIQEADVGVGIAGVEGRQAAMSSDYAIAQFRFLQRLMLVHG
RWDYRRLAESIANFFYKNVVWTFAIFWFEIFCDFDITYPFDYTYILLFNLIFTSLPVGIMGVLDQDVSDKVSLAV
PQLYRRGIERLEWTHSKFWFYMVDGLYQSVMVFFIPYLLFVPAQPVSFSGLGLEDRLRFGAYVAHPAVVTINAYI
LINTYRWDWLMLLVVSLSDLSIFFWTGVYSSFVSSGFFFKTAAEVYSEASFWAIFFIVPVICLFPRFAVKSLQKV
YWPYDVDIIREQEKMGAFAYLTEGSGSSNRHGSDGGSQKSGSSKKAKHILSGSVDDDLRPIYPPSTATRTTAHNR
TQNGSDSTNFSADASLDAAVATGANRLSAEVVPPDRRSDDRVRPSYDRMRPSYDRMRMSMDRVRPSFEASSDFTS
AARLQRIESTQNVGFKARLRGLSLTKNAAANSPLSPRSPRSPRTRR
Coding >Ophio5|2334
ATGACCACGGCCAATGGCTCCGGGCCTGGCGCCGACGGCAATCCGCCAAAGATTGAGCGCCCCCATCGGACACGC
TGGGCCACTCGAAAGATGACCATCAAAAGCGGTCGCTCCAAGCGTCTGTCGCTTCTCAACCGCATGCAACAACGG
AAACGCGCATCCAACGAGAAGCCCTCGGCCGGCGACACCTCGGAGCCGCCCCTGACGGACCGCAGTAGCGAAGAC
GGTTCTGATACCTCATCTCAATCGGAAGACAACGGCCGCACCCTCTACTTCAATCTGCCTCTTCCCGACGACCTG
CTGAGCGACGGCCATCCTATCCAAACTTTTCCCCGGAACAAGATTAGGACCGCAAAGTACACACCGCTCTCTTTC
GTGCCCAAGAACCTGTGGTTCCAGTTCCACAATGTGGCCAACATATTTTTCCTTTTCCTCGTCATTCTCGGTATA
TTTCCCATTTTCGGCGGCGTCAACCCCGGTCTCAACGCCGTCCCCCTCATCTTCATCATCGTCGTCACCGCAATC
AAGGACGCAGTCGAGGATTACCGACGTACCGTTCTCGACAACGAACTCAACAATGCCCCCGTCCACCGATTGTCG
CATTGGAACAATGTCAATGTCGAGGAGGGGACCGTCTCGTCCTGGAGGAGGTTTAAAAAGGCCAACACGAGACTG
TTTGGCTCCATGTGGCATGCCATCGAGAGTTTGTGGTCCCAAAAGGCCAGGACGGCCAGGGCTGAGCGCAAGGCG
CGCAAGCTGCAAGAGGCAGACCCGGAGGACGAGGTTCGCCCATCGGTCGAGACGACACGCACCAGAATGTCGGTC
CGTGAGGCTCTCTCCTCGCCCTTCAGCCACGAATCGTTCAAGTCCGCCGATGACGACATCCCCATGACCCCCGTC
GGCTCACCCAAAGCCGTCGGCGACCTGCCCACCCTCGAGCTGCCCGACGACCAAGACGCCAAGCGCGCCGCGTCG
CTGCGGTCCATGAAGTCCGATCTCGTCAACTACCGCCGCGCTCCGGAGGGGGCAAAGTTCAAAAAGGACACCTGG
AAGAGCATCCAGGTCGGCGACTTCGTGCGAATCTACAACGACGACGAGCTGCCCGCCGACGTCATCATCCTGTCC
ACCTCGGACCCCGACGGCGCCTGCTACGTCGAGACGAAGAACCTGGACGGTGAGACGAATCTCAAGGTTCGTCAG
GCTCTCCGCTGCGGCCGCACCCTCAAGCACGCCCGAGACTGCGAGAGGGCCGAGTTCCACATCCAGAGCGAGCCG
CCGCAGCCCAATCTTTACAAGTACAACGGCGCCATCCACTGGAAGCAAAGGGTCCCCGGCTGTCCCGAGGACGAG
CCGGCCAACATGACGGAGCCCATCACCATCGACAACCTGCTTCTTCGCGGCTGTAACCTACGCAACACCGAGTGG
GTGCTCGGCGTCGTCATCTTCACTGGACACGACACAAAGATCATGATGAACGCCGGCATCACCCCCAGCAAGCGC
TCGAGGATCGCCCGCGAGATGAACTTCAACGTCGTTTGTAACTTTGGCATCCTGCTCATCATGTGCCTGCTGTCG
GGCATCTTCAACGGCGTCGCTTGGTCCAAGACGGACGCCTCGCTGCATTTTTTCGACTTTGGTTCCATCGGCGGC
AGCGCCGCTATGAGCGGCTTCATCACCTTCTGGGCCGCCATCATTGTCTTCCAGAACCTGGTGCCCATCTCCCTC
TACATCACGCTCGAGATTGTCCGCACGCTACAGGCCGTTCTCATCTTCAGCGACATCGACATGTACTACGCCAAG
ATCGACCAACCGTGCATCCCCAAGTCGTGGAACATCTCCGATGACGTCGGCCAGATCGAATACATCTTTTCCGAC
AAGACTGGCACGCTCACGCAGAACGTCATGGAGTTCAAGAAGGCCTCCATCAACGGCCAGCCCTACGGTGAGGCC
TTCACGGAGGCGCAGGCTGGTATGCAGAAACGACTCGGCGTCGACGTGGTGGCCGAGGCGGCCAGGATCGAGACC
GAGATTGCCGAGGCCAAAGTCAAAGCACTGGCCGGTCTGCGGAAGCTGTACGACAACCCGTACCTTCACGACGGC
AGCGTCACCTTCATCGCCCCCGACTTCGTCTCCGACCTGGCGGGCCTAGGCGGGCCCCAGCAGCAGGCGGCTAAC
GAGGAGTTTATGCTCGCGCTGTCTCTGTGCCACACGGTCATCGCCGAGAGATCGCCCGGCGACCCACCGAGCATG
AACTTCAAGGCGCAGTCGCCCGACGAGGAGGCCCTGGTCGCCACCGCCCGCGACATGGGCTTCACCGTAATCAGC
AACAACAGCGACGGCATCGACCTGAACGTACTGGGCCAGGACCGCCACTACCCGATCCTCAATACGATTGAGTTC
AACTCGAGCAGGAAGCGGATGAGCTCCATCGTGCGCATGCCCGACGGCCAGATCGTCCTCTACTGCAAGGGCGCC
GACTCGGTCATCTACTCGCGCCTCAAGCGGGGCGAGCAGCAGCAGCTGCGGCGCCAGACGGCGGAGCAACTCGAG
ATGTTCGCCCGCGAAGGTCTTCGGACGCTCTGCATCGCGCGCAAGACACTGACGGAGAAGGAGTACGAGATGTGG
AAGAAGGAGCACGACGCGGCGGCGTCGGCGCTCGAGAACCGCGAGGAGAAATTGGAGACGGTGGCAGAGCTCATC
GAGCAGGACCTGATGCTACTGGGCGGCACGGCCATCGAAGATCGCCTGCAGGACGGCGTGCCCGACACCATCGCC
CTCCTCGGCCAGGCCGGCATGAAGCTGTGGGTGCTGACGGGCGACAAGGTCGAGACGGCCATCAACATCGGCTTC
TCGTGCAATCTGCTCAACAACGACATGGAGCTGATCCACCTCAAGCTCGACGAGGACGAGACGGGCGAGACGAGC
GACGAGACGTTCCTGGGCACGACGGAGAAGCTTCTGGAGCAGAACCTGCAGATGTTTGATCTGGTCGGCGACGAC
AGCGACCTTGCGGCGGCGAGGAAGAACCACGAGCCGCCGGCGCCGACGCACGGCCTCGTCATCGATGGCTTCACC
CTCCGCTGGGCCCTCAACGACCGGCTGCGGCAAAAGTTTCTGCTGCTGTGCAAGCAGTGCAAGTCGGTGCTGTGC
TGCCGCGTCAGCCCCGCGCAAAAGGCGGCCGTCGTGGCCATGGTCAAGACGGGGCTGGACGTGATGACGCTGTCG
ATTGGCGACGGTGCCAACGACGTGGCCATGATCCAAGAGGCCGACGTGGGCGTCGGTATCGCTGGTGTCGAGGGT
CGACAGGCGGCCATGTCGTCCGACTACGCCATTGCCCAGTTCCGCTTCCTGCAGAGGCTGATGCTGGTGCACGGC
CGGTGGGACTACCGGCGGCTGGCGGAGAGTATCGCCAACTTCTTCTACAAGAACGTGGTCTGGACCTTTGCCATC
TTCTGGTTCGAGATCTTCTGCGACTTCGACATCACCTACCCCTTCGACTACACCTACATTCTCCTGTTCAACCTC
ATCTTCACGTCGCTCCCCGTCGGCATCATGGGCGTGCTCGACCAGGACGTCTCGGACAAGGTGTCGCTGGCCGTG
CCTCAGCTGTACCGAAGGGGTATCGAACGGCTGGAGTGGACGCACAGCAAGTTTTGGTTTTACATGGTCGACGGC
CTCTACCAGTCCGTCATGGTCTTCTTCATCCCATACCTGCTGTTCGTTCCGGCCCAGCCGGTCAGCTTCTCCGGG
CTCGGCCTCGAGGATAGGCTTCGGTTCGGCGCCTACGTGGCGCATCCCGCCGTGGTGACGATCAACGCCTACATC
CTGATCAACACGTACCGGTGGGATTGGCTGATGCTGCTCGTGGTGAGCCTCAGCGACCTGTCCATCTTCTTCTGG
ACGGGCGTCTACTCGTCCTTTGTCTCGTCGGGCTTCTTCTTCAAGACGGCGGCCGAGGTGTACAGCGAGGCCAGC
TTCTGGGCCATCTTCTTCATCGTCCCCGTCATCTGCCTCTTCCCGCGCTTCGCCGTCAAGTCGCTGCAGAAGGTC
TACTGGCCATACGACGTGGACATTATCCGCGAGCAGGAGAAGATGGGCGCCTTCGCCTACCTGACGGAGGGCAGC
GGATCCAGCAACCGGCACGGCAGCGACGGAGGCAGCCAGAAGTCAGGCAGCTCGAAGAAGGCCAAGCACATACTC
AGCGGCAGCGTCGACGACGACCTGCGGCCCATCTATCCGCCGTCGACGGCGACGCGGACGACGGCCCACAACCGG
ACACAGAACGGCAGCGACTCGACCAACTTTTCGGCCGACGCGTCGCTCGACGCGGCCGTCGCCACGGGCGCTAAT
CGGCTATCAGCGGAGGTGGTGCCTCCGGACCGACGGTCGGACGACCGGGTGAGGCCGTCGTACGACCGGATGCGG
CCGTCGTACGACCGGATGCGCATGTCAATGGATCGCGTCCGGCCGAGCTTCGAGGCGAGCAGCGATTTCACCTCG
GCGGCGCGGCTGCAGCGCATCGAGTCGACGCAAAATGTCGGCTTTAAGGCCAGACTCCGAGGCCTGTCGCTGACC
AAGAACGCGGCGGCGAACTCGCCGCTGAGCCCGCGTTCTCCGCGGTCGCCGAGGACGCGGCGC
Transcript >Ophio5|2334
ATGACCACGGCCAATGGCTCCGGGCCTGGCGCCGACGGCAATCCGCCAAAGATTGAGCGCCCCCATCGGACACGC
TGGGCCACTCGAAAGATGACCATCAAAAGCGGTCGCTCCAAGCGTCTGTCGCTTCTCAACCGCATGCAACAACGG
AAACGCGCATCCAACGAGAAGCCCTCGGCCGGCGACACCTCGGAGCCGCCCCTGACGGACCGCAGTAGCGAAGAC
GGTTCTGATACCTCATCTCAATCGGAAGACAACGGCCGCACCCTCTACTTCAATCTGCCTCTTCCCGACGACCTG
CTGAGCGACGGCCATCCTATCCAAACTTTTCCCCGGAACAAGATTAGGACCGCAAAGTACACACCGCTCTCTTTC
GTGCCCAAGAACCTGTGGTTCCAGTTCCACAATGTGGCCAACATATTTTTCCTTTTCCTCGTCATTCTCGGTATA
TTTCCCATTTTCGGCGGCGTCAACCCCGGTCTCAACGCCGTCCCCCTCATCTTCATCATCGTCGTCACCGCAATC
AAGGACGCAGTCGAGGATTACCGACGTACCGTTCTCGACAACGAACTCAACAATGCCCCCGTCCACCGATTGTCG
CATTGGAACAATGTCAATGTCGAGGAGGGGACCGTCTCGTCCTGGAGGAGGTTTAAAAAGGCCAACACGAGACTG
TTTGGCTCCATGTGGCATGCCATCGAGAGTTTGTGGTCCCAAAAGGCCAGGACGGCCAGGGCTGAGCGCAAGGCG
CGCAAGCTGCAAGAGGCAGACCCGGAGGACGAGGTTCGCCCATCGGTCGAGACGACACGCACCAGAATGTCGGTC
CGTGAGGCTCTCTCCTCGCCCTTCAGCCACGAATCGTTCAAGTCCGCCGATGACGACATCCCCATGACCCCCGTC
GGCTCACCCAAAGCCGTCGGCGACCTGCCCACCCTCGAGCTGCCCGACGACCAAGACGCCAAGCGCGCCGCGTCG
CTGCGGTCCATGAAGTCCGATCTCGTCAACTACCGCCGCGCTCCGGAGGGGGCAAAGTTCAAAAAGGACACCTGG
AAGAGCATCCAGGTCGGCGACTTCGTGCGAATCTACAACGACGACGAGCTGCCCGCCGACGTCATCATCCTGTCC
ACCTCGGACCCCGACGGCGCCTGCTACGTCGAGACGAAGAACCTGGACGGTGAGACGAATCTCAAGGTTCGTCAG
GCTCTCCGCTGCGGCCGCACCCTCAAGCACGCCCGAGACTGCGAGAGGGCCGAGTTCCACATCCAGAGCGAGCCG
CCGCAGCCCAATCTTTACAAGTACAACGGCGCCATCCACTGGAAGCAAAGGGTCCCCGGCTGTCCCGAGGACGAG
CCGGCCAACATGACGGAGCCCATCACCATCGACAACCTGCTTCTTCGCGGCTGTAACCTACGCAACACCGAGTGG
GTGCTCGGCGTCGTCATCTTCACTGGACACGACACAAAGATCATGATGAACGCCGGCATCACCCCCAGCAAGCGC
TCGAGGATCGCCCGCGAGATGAACTTCAACGTCGTTTGTAACTTTGGCATCCTGCTCATCATGTGCCTGCTGTCG
GGCATCTTCAACGGCGTCGCTTGGTCCAAGACGGACGCCTCGCTGCATTTTTTCGACTTTGGTTCCATCGGCGGC
AGCGCCGCTATGAGCGGCTTCATCACCTTCTGGGCCGCCATCATTGTCTTCCAGAACCTGGTGCCCATCTCCCTC
TACATCACGCTCGAGATTGTCCGCACGCTACAGGCCGTTCTCATCTTCAGCGACATCGACATGTACTACGCCAAG
ATCGACCAACCGTGCATCCCCAAGTCGTGGAACATCTCCGATGACGTCGGCCAGATCGAATACATCTTTTCCGAC
AAGACTGGCACGCTCACGCAGAACGTCATGGAGTTCAAGAAGGCCTCCATCAACGGCCAGCCCTACGGTGAGGCC
TTCACGGAGGCGCAGGCTGGTATGCAGAAACGACTCGGCGTCGACGTGGTGGCCGAGGCGGCCAGGATCGAGACC
GAGATTGCCGAGGCCAAAGTCAAAGCACTGGCCGGTCTGCGGAAGCTGTACGACAACCCGTACCTTCACGACGGC
AGCGTCACCTTCATCGCCCCCGACTTCGTCTCCGACCTGGCGGGCCTAGGCGGGCCCCAGCAGCAGGCGGCTAAC
GAGGAGTTTATGCTCGCGCTGTCTCTGTGCCACACGGTCATCGCCGAGAGATCGCCCGGCGACCCACCGAGCATG
AACTTCAAGGCGCAGTCGCCCGACGAGGAGGCCCTGGTCGCCACCGCCCGCGACATGGGCTTCACCGTAATCAGC
AACAACAGCGACGGCATCGACCTGAACGTACTGGGCCAGGACCGCCACTACCCGATCCTCAATACGATTGAGTTC
AACTCGAGCAGGAAGCGGATGAGCTCCATCGTGCGCATGCCCGACGGCCAGATCGTCCTCTACTGCAAGGGCGCC
GACTCGGTCATCTACTCGCGCCTCAAGCGGGGCGAGCAGCAGCAGCTGCGGCGCCAGACGGCGGAGCAACTCGAG
ATGTTCGCCCGCGAAGGTCTTCGGACGCTCTGCATCGCGCGCAAGACACTGACGGAGAAGGAGTACGAGATGTGG
AAGAAGGAGCACGACGCGGCGGCGTCGGCGCTCGAGAACCGCGAGGAGAAATTGGAGACGGTGGCAGAGCTCATC
GAGCAGGACCTGATGCTACTGGGCGGCACGGCCATCGAAGATCGCCTGCAGGACGGCGTGCCCGACACCATCGCC
CTCCTCGGCCAGGCCGGCATGAAGCTGTGGGTGCTGACGGGCGACAAGGTCGAGACGGCCATCAACATCGGCTTC
TCGTGCAATCTGCTCAACAACGACATGGAGCTGATCCACCTCAAGCTCGACGAGGACGAGACGGGCGAGACGAGC
GACGAGACGTTCCTGGGCACGACGGAGAAGCTTCTGGAGCAGAACCTGCAGATGTTTGATCTGGTCGGCGACGAC
AGCGACCTTGCGGCGGCGAGGAAGAACCACGAGCCGCCGGCGCCGACGCACGGCCTCGTCATCGATGGCTTCACC
CTCCGCTGGGCCCTCAACGACCGGCTGCGGCAAAAGTTTCTGCTGCTGTGCAAGCAGTGCAAGTCGGTGCTGTGC
TGCCGCGTCAGCCCCGCGCAAAAGGCGGCCGTCGTGGCCATGGTCAAGACGGGGCTGGACGTGATGACGCTGTCG
ATTGGCGACGGTGCCAACGACGTGGCCATGATCCAAGAGGCCGACGTGGGCGTCGGTATCGCTGGTGTCGAGGGT
CGACAGGCGGCCATGTCGTCCGACTACGCCATTGCCCAGTTCCGCTTCCTGCAGAGGCTGATGCTGGTGCACGGC
CGGTGGGACTACCGGCGGCTGGCGGAGAGTATCGCCAACTTCTTCTACAAGAACGTGGTCTGGACCTTTGCCATC
TTCTGGTTCGAGATCTTCTGCGACTTCGACATCACCTACCCCTTCGACTACACCTACATTCTCCTGTTCAACCTC
ATCTTCACGTCGCTCCCCGTCGGCATCATGGGCGTGCTCGACCAGGACGTCTCGGACAAGGTGTCGCTGGCCGTG
CCTCAGCTGTACCGAAGGGGTATCGAACGGCTGGAGTGGACGCACAGCAAGTTTTGGTTTTACATGGTCGACGGC
CTCTACCAGTCCGTCATGGTCTTCTTCATCCCATACCTGCTGTTCGTTCCGGCCCAGCCGGTCAGCTTCTCCGGG
CTCGGCCTCGAGGATAGGCTTCGGTTCGGCGCCTACGTGGCGCATCCCGCCGTGGTGACGATCAACGCCTACATC
CTGATCAACACGTACCGGTGGGATTGGCTGATGCTGCTCGTGGTGAGCCTCAGCGACCTGTCCATCTTCTTCTGG
ACGGGCGTCTACTCGTCCTTTGTCTCGTCGGGCTTCTTCTTCAAGACGGCGGCCGAGGTGTACAGCGAGGCCAGC
TTCTGGGCCATCTTCTTCATCGTCCCCGTCATCTGCCTCTTCCCGCGCTTCGCCGTCAAGTCGCTGCAGAAGGTC
TACTGGCCATACGACGTGGACATTATCCGCGAGCAGGAGAAGATGGGCGCCTTCGCCTACCTGACGGAGGGCAGC
GGATCCAGCAACCGGCACGGCAGCGACGGAGGCAGCCAGAAGTCAGGCAGCTCGAAGAAGGCCAAGCACATACTC
AGCGGCAGCGTCGACGACGACCTGCGGCCCATCTATCCGCCGTCGACGGCGACGCGGACGACGGCCCACAACCGG
ACACAGAACGGCAGCGACTCGACCAACTTTTCGGCCGACGCGTCGCTCGACGCGGCCGTCGCCACGGGCGCTAAT
CGGCTATCAGCGGAGGTGGTGCCTCCGGACCGACGGTCGGACGACCGGGTGAGGCCGTCGTACGACCGGATGCGG
CCGTCGTACGACCGGATGCGCATGTCAATGGATCGCGTCCGGCCGAGCTTCGAGGCGAGCAGCGATTTCACCTCG
GCGGCGCGGCTGCAGCGCATCGAGTCGACGCAAAATGTCGGCTTTAAGGCCAGACTCCGAGGCCTGTCGCTGACC
AAGAACGCGGCGGCGAACTCGCCGCTGAGCCCGCGTTCTCCGCGGTCGCCGAGGACGCGGCGCTAA
Gene >Ophio5|2334
ATGACCACGGCCAATGGCTCCGGGCCTGGCGCCGACGGCAATCCGCCAAAGATTGAGCGCCCCCATCGGACACGC
TGGGCCACTCGAAAGATGACCATCAAAAGCGGTCGCTCCAAGCGTCTGTCGCTTCTCAACCGCATGCAACAACGG
AAACGCGCATCCAACGAGAAGCCCTCGGCCGGCGACACCTCGGAGCCGCCCCTGACGGACCGCAGTAGCGAAGAC
GGTTCTGATACCTCATCTCAATCGGAAGACAACGGCCGCACCCTCTACTTCAATCTGCCTCTTCCCGACGACCTG
CTGAGCGACGGCCATCCTATCCAAACTTTTCCCCGGAACAAGATTAGGACCGCAAAGTACACACCGCTCTCTTTC
GTGCCCAAGAACCTGTGGTTCCAGTTCCACAATGTGGCCAACATATTTTTCCTTTTCCTCGTCATTCTCGGTGTG
AGTAAATCCTTGTCCTCCCCCTGAACCCCTCGCCTCGCCTCGTCTCGTCCCGCACCCATTGCCGTCGGCCGGATC
GTTAATCCTCCCCTTTTCCGCAGATATTTCCCATTTTCGGCGGCGTCAACCCCGGTCTCAACGCCGTCCCCCTCA
TCTTCATCATCGTCGTCACCGCAATCAAGGACGCAGTCGAGGATTACCGACGTACCGTTCTCGACAACGAACTCA
ACAATGCCCCCGTCCACCGATTGTCGCATTGGAACAATGTCAATGTCGAGGAGGGGACCGTCTCGTCCTGGAGGA
GGTTTAAAAAGGCCAACACGAGACTGTTTGGCTCCATGTGGCATGCCATCGAGAGTTTGTGGTCCCAAAAGGCCA
GGACGGCCAGGGCTGAGCGCAAGGCGCGCAAGCTGCAAGAGGCAGACCCGGAGGACGAGGTTCGCCCATCGGTCG
AGACGACACGCACCAGAATGTCGGTCCGTGAGGCTCTCTCCTCGCCCTTCAGCCACGAATCGTTCAAGTCCGCCG
ATGACGACATCCCCATGACCCCCGTCGGCTCACCCAAAGCCGTCGGCGACCTGCCCACCCTCGAGCTGCCCGACG
ACCAAGACGCCAAGCGCGCCGCGTCGCTGCGGTCCATGAAGTCCGATCTCGTCAACTACCGCCGCGCTCCGGAGG
GGGCAAAGTTCAAAAAGGACACCTGGAAGAGCATCCAGGTCGGCGACTTCGTGCGAATCTACAACGACGACGAGC
TGCCCGCCGACGTCATCATCCTGTCCACCTCGGACCCCGACGGCGCCTGCTACGTCGAGACGAAGAACCTGGACG
GTGAGACGAATCTCAAGGTTCGTCAGGCTCTCCGCTGCGGCCGCACCCTCAAGCACGCCCGAGACTGCGAGAGGG
CCGAGTTCCACATCCAGAGCGAGCCGCCGCAGCCCAATCTTTACAAGTACAACGGCGCCATCCACTGGAAGCAAA
GGGTCCCCGGCTGTCCCGAGGACGAGCCGGCCAACATGACGGAGCCCATCACCATCGACAACCTGCTTCTTCGCG
GCTGTAACCTACGCAACACCGAGTGGGTGCTCGGCGTCGTCATCTTCACTGGACACGACACAAAGATCATGATGA
ACGCCGGCATCACCCCCAGCAAGCGCTCGAGGATCGCCCGCGAGATGAACTTCAACGTCGTTTGTAACTTTGGCA
TCCTGCTCATCATGTGCCTGCTGTCGGGCATCTTCAACGGCGTCGCTTGGTCCAAGACGGACGCCTCGCTGCATT
TTTTCGACTTTGGTTCCATCGGCGGCAGCGCCGCTATGAGCGGCTTCATCACCTTCTGGGCCGCCATCATTGTCT
TCCAGAACCTGGTGCCCATCTCCCTCTACATCACGCTCGAGATTGTCCGCACGCTACAGGCCGTTCTCATCTTCA
GCGACATCGACATGTACTACGCCAAGATCGACCAACCGTGCATCCCCAAGTCGTGGAACATCTCCGATGACGTCG
GCCAGATCGAATACATCTTTTCCGACAAGACTGGCACGCTCACGCAGAACGTCATGGAGTTCAAGAAGGCCTCCA
TCAACGGCCAGCCCTACGGTGAGGCCTTCACGGAGGCGCAGGCTGGTATGCAGAAACGACTCGGCGTCGACGTGG
TGGCCGAGGCGGCCAGGATCGAGACCGAGATTGCCGAGGCCAAAGTCAAAGCACTGGCCGGTCTGCGGAAGCTGT
ACGACAACCCGTACCTTCACGACGGCAGCGTCACCTTCATCGCCCCCGACTTCGTCTCCGACCTGGCGGGCCTAG
GCGGGCCCCAGCAGCAGGCGGCTAACGAGGAGTTTATGCTCGCGCTGTCTCTGTGCCACACGGTCATCGCCGAGA
GATCGCCCGGCGACCCACCGAGCATGAACTTCAAGGCGCAGTCGCCCGACGAGGAGGCCCTGGTCGCCACCGCCC
GCGACATGGGCTTCACCGTAATCAGCAACAACAGCGACGGCATCGACCTGAACGTACTGGGCCAGGACCGCCACT
ACCCGATCCTCAATACGATTGAGTTCAACTCGAGCAGGAAGCGGATGAGCTCCATCGTGCGCATGCCCGACGGCC
AGATCGTCCTCTACTGCAAGGGCGCCGACTCGGTCATCTACTCGCGCCTCAAGCGGGGCGAGCAGCAGCAGCTGC
GGCGCCAGACGGCGGAGCAACTCGAGATGTTCGCCCGCGAAGGTCTTCGGACGCTCTGCATCGCGCGCAAGACAC
TGACGGAGAAGGAGTACGAGATGTGGAAGAAGGAGCACGACGCGGCGGCGTCGGCGCTCGAGAACCGCGAGGAGA
AATTGGAGACGGTGGCAGAGCTCATCGAGCAGGACCTGATGCTACTGGGCGGCACGGCCATCGAAGATCGCCTGC
AGGACGGCGTGCCCGACACCATCGCCCTCCTCGGCCAGGCCGGCATGAAGCTGTGGGTGCTGACGGGCGACAAGG
TCGAGACGGCCATCAACATCGGCTTCTCGTGCAATCTGCTCAACAACGACATGGAGCTGATCCACCTCAAGCTCG
ACGAGGACGAGACGGGCGAGACGAGCGACGAGACGTTCCTGGGCACGACGGAGAAGCTTCTGGAGCAGAACCTGC
AGATGTTTGATCTGGTCGGCGACGACAGCGACCTTGCGGCGGCGAGGAAGAACCACGAGCCGCCGGCGCCGACGC
ACGGCCTCGTCATCGATGGCTTCACCCTCCGCTGGGCCCTCAACGACCGGCTGCGGCAAAAGTTTCTGCTGCTGT
GCAAGCAGTGCAAGTCGGTGCTGTGCTGCCGCGTCAGCCCCGCGCAAAAGGCGGCCGTCGTGGCCATGGTCAAGA
CGGGGCTGGACGTGATGACGCTGTCGATTGGCGACGGTGCCAACGACGTGGCCATGATCCAAGAGGCCGACGTGG
GCGTCGGTATCGCTGGTGTCGAGGGTCGACAGGCGGCCATGTCGTCCGACTACGCCATTGCCCAGTTCCGCTTCC
TGCAGAGGCTGATGCTGGTGCACGGCCGGTGGGACTACCGGCGGCTGGCGGAGAGTATCGCCAACTTCTTCTACA
AGAACGTGGTCTGGACCTTTGCCATCTTCTGGTTCGAGATCTTCTGCGACTTCGACATCACCTACCCCTTCGACT
ACACCTACATTCTCCTGTTCAACCTCATCTTCACGTCGCTCCCCGTCGGCATCATGGGCGTGCTCGACCAGGACG
TCTCGGACAAGGTGTCGCTGGCCGTGCCTCAGCTGTACCGAAGGGGTATCGAACGGCTGGAGTGGACGCACAGCA
AGTTTTGGTGAGTGCAGAGACGGACCCCGATTCTCTAACCTGCGGCGGCTAACGAAAGCACAGGTTTTACATGGT
CGACGGCCTCTACCAGTCCGTCATGGTCTTCTTCATCCCATACCTGCTGTTCGTTCCGGCCCAGCCGGTCAGCTT
CTCCGGGCTCGGCCTCGAGGATAGGCTTCGGTTCGGCGCCTACGTGGCGCATCCCGCCGTGGTGACGATCAACGC
CTACATCCTGATCAACACGTACCGGTGGGATTGGCTGATGCTGCTCGTGGTGAGCCTCAGCGACCTGTCCATCTT
CTTCTGGACGGGCGTCTACTCGTCCTTTGTCTCGTCGGGCTTCTTCTTCAAGACGGCGGCCGAGGTGTACAGCGA
GGCCAGCTTCTGGGCCATCTTCTTCATCGTCCCCGTCATCTGCCTCTTCCCGCGCTTCGCCGTCAAGTCGCTGCA
GAAGGTCTACTGGCCATACGACGTGGACATTATCCGCGAGCAGGAGAAGATGGGCGCCTTCGCCTACCTGACGGA
GGGCAGCGGATCCAGCAACCGGCACGGCAGCGACGGAGGCAGCCAGAAGTCAGGCAGCTCGAAGAAGGCCAAGCA
CATACTCAGCGGCAGCGTCGACGACGACCTGCGGCCCATCTATCCGCCGTCGACGGCGACGCGGACGACGGCCCA
CAACCGGACACAGAACGGCAGCGACTCGACCAACTTTTCGGCCGACGCGTCGCTCGACGCGGCCGTCGCCACGGG
CGCTAATCGGCTATCAGCGGAGGTGGTGCCTCCGGACCGACGGTCGGACGACCGGGTGAGGCCGTCGTACGACCG
GATGCGGCCGTCGTACGACCGGATGCGCATGTCAATGGATCGCGTCCGGCCGAGCTTCGAGGCGAGCAGCGATTT
CACCTCGGCGGCGCGGCTGCAGCGCATCGAGTCGACGCAAAATGTCGGCTTTAAGGCCAGACTCCGAGGCCTGTC
GCTGACCAAGAACGCGGCGGCGAACTCGCCGCTGAGCCCGCGTTCTCCGCGGTCGCCGAGGACGCGGCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail