Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|2334
Gene name
Locationscaffold_199:26813..31611
Strand-
Gene length (bp)4798
Transcript length (bp)4641
Coding sequence length (bp)4638
Protein length (aa) 1546

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 1.8E-74 1104 1353
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 1.2E-18 108 158
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.2E-12 751 833
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 2.3E-07 620 986

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 21 1374 0.0E+00
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 10 1374 0.0E+00
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 75 1361 0.0E+00
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 48 1362 0.0E+00
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 350 1361 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 21 1374 0.0E+00
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 10 1374 0.0E+00
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 75 1361 0.0E+00
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 48 1362 0.0E+00
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 350 1361 0.0E+00
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 345 1360 0.0E+00
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 343 1364 0.0E+00
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 345 1360 0.0E+00
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 296 1364 0.0E+00
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 343 1364 0.0E+00
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 318 1364 0.0E+00
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 326 1364 0.0E+00
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 343 1357 0.0E+00
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 345 1353 0.0E+00
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 350 1363 0.0E+00
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 350 1343 0.0E+00
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 341 1370 0.0E+00
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 343 1361 0.0E+00
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 345 1353 0.0E+00
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 345 1353 0.0E+00
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 350 1363 0.0E+00
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 350 1383 0.0E+00
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 327 1366 0.0E+00
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 349 1343 0.0E+00
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 327 1361 0.0E+00
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 350 1343 0.0E+00
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 327 1361 0.0E+00
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 350 1357 0.0E+00
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 326 1368 0.0E+00
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 342 1307 0.0E+00
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 342 1293 6.0E-179
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 351 1339 2.0E-173
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 350 1353 5.0E-167
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 351 1339 1.0E-165
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 341 1353 3.0E-161
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 341 1353 3.0E-159
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 341 1350 1.0E-147
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 341 1350 8.0E-142
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 706 1364 3.0E-133
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 727 1363 5.0E-133
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 750 1361 6.0E-133
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 748 1348 6.0E-132
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 740 1395 7.0E-130
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 740 1425 3.0E-128
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 749 1350 3.0E-126
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 352 1353 1.0E-101
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 352 1353 2.0E-100
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 353 1353 4.0E-99
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 353 1353 2.0E-98
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 353 1353 4.0E-98
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 353 1353 4.0E-97
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 353 1353 5.0E-97
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 351 1353 3.0E-96
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 351 1353 8.0E-95
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 728 1367 1.0E-92
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 813 1363 4.0E-77
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 819 1374 1.0E-72
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 351 896 3.0E-66
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 294 647 8.0E-63
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 350 650 1.0E-62
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 294 647 5.0E-62
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 341 649 8.0E-59
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 341 649 8.0E-58
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 331 665 3.0E-57
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 350 647 2.0E-45
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 351 655 3.0E-33
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 107 193 2.0E-18
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 795 1186 3.0E-18
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 109 207 7.0E-18
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 728 837 1.0E-17
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 110 193 4.0E-17
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 108 193 1.0E-15
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 47 228 2.0E-14
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 108 201 2.0E-14
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 108 201 3.0E-14
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 55 193 6.0E-14
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 76 197 8.0E-14
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 110 228 1.0E-13
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 76 197 1.0E-13
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 784 1104 1.0E-13
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 110 207 8.0E-13
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 47 209 9.0E-13
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 47 209 1.0E-12
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 800 1180 1.0E-12
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 800 979 1.0E-12
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 110 196 2.0E-12
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 788 977 3.0E-12
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 707 1104 3.0E-12
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 800 979 4.0E-12
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 788 977 5.0E-12
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 76 212 6.0E-12
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 88 198 1.0E-11
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 105 208 1.0E-11
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 614 958 1.0E-11
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 110 207 2.0E-11
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 88 208 2.0E-11
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 800 977 2.0E-11
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 800 977 2.0E-11
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 800 979 4.0E-11
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 800 977 6.0E-11
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 87 212 7.0E-11
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 110 198 7.0E-11
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 785 977 7.0E-11
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 108 207 9.0E-11
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 794 1104 9.0E-11
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 105 219 1.0E-10
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 110 198 1.0E-10
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 756 1180 1.0E-10
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 76 212 2.0E-10
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 72 207 2.0E-10
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 75 207 2.0E-10
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 97 207 3.0E-10
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 794 1100 3.0E-10
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 113 196 4.0E-10
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 800 1180 4.0E-10
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 800 986 5.0E-10
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 800 1180 5.0E-10
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 756 1180 6.0E-10
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 108 207 9.0E-10
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 794 971 9.0E-10
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 113 207 1.0E-09
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 113 222 1.0E-09
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 108 199 1.0E-09
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 103 209 1.0E-09
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 800 1180 1.0E-09
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 800 1180 1.0E-09
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 88 207 2.0E-09
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 108 202 3.0E-09
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 110 207 7.0E-09
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 731 1104 7.0E-09
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 800 979 9.0E-09
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 110 207 2.0E-08
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 104 212 2.0E-08
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 104 212 2.0E-08
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 800 979 3.0E-08
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 780 954 3.0E-08
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 757 973 4.0E-08
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 800 958 4.0E-08
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 794 1104 4.0E-08
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 353 959 4.0E-08
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 795 1104 4.0E-08
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 794 1100 6.0E-08
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 614 958 6.0E-08
sp|P39986|ATC6_YEAST Manganese-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPF1 PE=1 SV=1 764 1140 8.0E-08
sp|O14022|CTA5_SCHPO Cation-transporting ATPase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta5 PE=3 SV=1 787 1104 1.0E-07
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 788 955 3.0E-07
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 104 212 4.0E-07
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 110 207 9.0E-07
sp|Q9LT02|PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana GN=PDR2 PE=1 SV=1 787 1095 9.0E-07
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 800 955 9.0E-07
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 110 207 2.0E-06
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 800 958 2.0E-06
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 800 958 2.0E-06
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 110 209 3.0E-06
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 78 201 5.0E-06
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 41 193 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 140 174 34
2 511 533 22
3 557 579 22
4 1139 1156 17
5 1166 1188 22
6 1218 1240 22
7 1260 1277 17
8 1284 1306 22
9 1326 1344 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|2334
MTTANGSGPGADGNPPKIERPHRTRWATRKMTIKSGRSKRLSLLNRMQQRKRASNEKPSAGDTSEPPLTDRSSED
GSDTSSQSEDNGRTLYFNLPLPDDLLSDGHPIQTFPRNKIRTAKYTPLSFVPKNLWFQFHNVANIFFLFLVILGI
FPIFGGVNPGLNAVPLIFIIVVTAIKDAVEDYRRTVLDNELNNAPVHRLSHWNNVNVEEGTVSSWRRFKKANTRL
FGSMWHAIESLWSQKARTARAERKARKLQEADPEDEVRPSVETTRTRMSVREALSSPFSHESFKSADDDIPMTPV
GSPKAVGDLPTLELPDDQDAKRAASLRSMKSDLVNYRRAPEGAKFKKDTWKSIQVGDFVRIYNDDELPADVIILS
TSDPDGACYVETKNLDGETNLKVRQALRCGRTLKHARDCERAEFHIQSEPPQPNLYKYNGAIHWKQRVPGCPEDE
PANMTEPITIDNLLLRGCNLRNTEWVLGVVIFTGHDTKIMMNAGITPSKRSRIAREMNFNVVCNFGILLIMCLLS
GIFNGVAWSKTDASLHFFDFGSIGGSAAMSGFITFWAAIIVFQNLVPISLYITLEIVRTLQAVLIFSDIDMYYAK
IDQPCIPKSWNISDDVGQIEYIFSDKTGTLTQNVMEFKKASINGQPYGEAFTEAQAGMQKRLGVDVVAEAARIET
EIAEAKVKALAGLRKLYDNPYLHDGSVTFIAPDFVSDLAGLGGPQQQAANEEFMLALSLCHTVIAERSPGDPPSM
NFKAQSPDEEALVATARDMGFTVISNNSDGIDLNVLGQDRHYPILNTIEFNSSRKRMSSIVRMPDGQIVLYCKGA
DSVIYSRLKRGEQQQLRRQTAEQLEMFAREGLRTLCIARKTLTEKEYEMWKKEHDAAASALENREEKLETVAELI
EQDLMLLGGTAIEDRLQDGVPDTIALLGQAGMKLWVLTGDKVETAINIGFSCNLLNNDMELIHLKLDEDETGETS
DETFLGTTEKLLEQNLQMFDLVGDDSDLAAARKNHEPPAPTHGLVIDGFTLRWALNDRLRQKFLLLCKQCKSVLC
CRVSPAQKAAVVAMVKTGLDVMTLSIGDGANDVAMIQEADVGVGIAGVEGRQAAMSSDYAIAQFRFLQRLMLVHG
RWDYRRLAESIANFFYKNVVWTFAIFWFEIFCDFDITYPFDYTYILLFNLIFTSLPVGIMGVLDQDVSDKVSLAV
PQLYRRGIERLEWTHSKFWFYMVDGLYQSVMVFFIPYLLFVPAQPVSFSGLGLEDRLRFGAYVAHPAVVTINAYI
LINTYRWDWLMLLVVSLSDLSIFFWTGVYSSFVSSGFFFKTAAEVYSEASFWAIFFIVPVICLFPRFAVKSLQKV
YWPYDVDIIREQEKMGAFAYLTEGSGSSNRHGSDGGSQKSGSSKKAKHILSGSVDDDLRPIYPPSTATRTTAHNR
TQNGSDSTNFSADASLDAAVATGANRLSAEVVPPDRRSDDRVRPSYDRMRPSYDRMRMSMDRVRPSFEASSDFTS
AARLQRIESTQNVGFKARLRGLSLTKNAAANSPLSPRSPRSPRTRR
Coding >Ophio5|2334
ATGACCACGGCCAATGGCTCCGGGCCTGGCGCCGACGGCAATCCGCCAAAGATTGAGCGCCCCCATCGGACACGC
TGGGCCACTCGAAAGATGACCATCAAAAGCGGTCGCTCCAAGCGTCTGTCGCTTCTCAACCGCATGCAACAACGG
AAACGCGCATCCAACGAGAAGCCCTCGGCCGGCGACACCTCGGAGCCGCCCCTGACGGACCGCAGTAGCGAAGAC
GGTTCTGATACCTCATCTCAATCGGAAGACAACGGCCGCACCCTCTACTTCAATCTGCCTCTTCCCGACGACCTG
CTGAGCGACGGCCATCCTATCCAAACTTTTCCCCGGAACAAGATTAGGACCGCAAAGTACACACCGCTCTCTTTC
GTGCCCAAGAACCTGTGGTTCCAGTTCCACAATGTGGCCAACATATTTTTCCTTTTCCTCGTCATTCTCGGTATA
TTTCCCATTTTCGGCGGCGTCAACCCCGGTCTCAACGCCGTCCCCCTCATCTTCATCATCGTCGTCACCGCAATC
AAGGACGCAGTCGAGGATTACCGACGTACCGTTCTCGACAACGAACTCAACAATGCCCCCGTCCACCGATTGTCG
CATTGGAACAATGTCAATGTCGAGGAGGGGACCGTCTCGTCCTGGAGGAGGTTTAAAAAGGCCAACACGAGACTG
TTTGGCTCCATGTGGCATGCCATCGAGAGTTTGTGGTCCCAAAAGGCCAGGACGGCCAGGGCTGAGCGCAAGGCG
CGCAAGCTGCAAGAGGCAGACCCGGAGGACGAGGTTCGCCCATCGGTCGAGACGACACGCACCAGAATGTCGGTC
CGTGAGGCTCTCTCCTCGCCCTTCAGCCACGAATCGTTCAAGTCCGCCGATGACGACATCCCCATGACCCCCGTC
GGCTCACCCAAAGCCGTCGGCGACCTGCCCACCCTCGAGCTGCCCGACGACCAAGACGCCAAGCGCGCCGCGTCG
CTGCGGTCCATGAAGTCCGATCTCGTCAACTACCGCCGCGCTCCGGAGGGGGCAAAGTTCAAAAAGGACACCTGG
AAGAGCATCCAGGTCGGCGACTTCGTGCGAATCTACAACGACGACGAGCTGCCCGCCGACGTCATCATCCTGTCC
ACCTCGGACCCCGACGGCGCCTGCTACGTCGAGACGAAGAACCTGGACGGTGAGACGAATCTCAAGGTTCGTCAG
GCTCTCCGCTGCGGCCGCACCCTCAAGCACGCCCGAGACTGCGAGAGGGCCGAGTTCCACATCCAGAGCGAGCCG
CCGCAGCCCAATCTTTACAAGTACAACGGCGCCATCCACTGGAAGCAAAGGGTCCCCGGCTGTCCCGAGGACGAG
CCGGCCAACATGACGGAGCCCATCACCATCGACAACCTGCTTCTTCGCGGCTGTAACCTACGCAACACCGAGTGG
GTGCTCGGCGTCGTCATCTTCACTGGACACGACACAAAGATCATGATGAACGCCGGCATCACCCCCAGCAAGCGC
TCGAGGATCGCCCGCGAGATGAACTTCAACGTCGTTTGTAACTTTGGCATCCTGCTCATCATGTGCCTGCTGTCG
GGCATCTTCAACGGCGTCGCTTGGTCCAAGACGGACGCCTCGCTGCATTTTTTCGACTTTGGTTCCATCGGCGGC
AGCGCCGCTATGAGCGGCTTCATCACCTTCTGGGCCGCCATCATTGTCTTCCAGAACCTGGTGCCCATCTCCCTC
TACATCACGCTCGAGATTGTCCGCACGCTACAGGCCGTTCTCATCTTCAGCGACATCGACATGTACTACGCCAAG
ATCGACCAACCGTGCATCCCCAAGTCGTGGAACATCTCCGATGACGTCGGCCAGATCGAATACATCTTTTCCGAC
AAGACTGGCACGCTCACGCAGAACGTCATGGAGTTCAAGAAGGCCTCCATCAACGGCCAGCCCTACGGTGAGGCC
TTCACGGAGGCGCAGGCTGGTATGCAGAAACGACTCGGCGTCGACGTGGTGGCCGAGGCGGCCAGGATCGAGACC
GAGATTGCCGAGGCCAAAGTCAAAGCACTGGCCGGTCTGCGGAAGCTGTACGACAACCCGTACCTTCACGACGGC
AGCGTCACCTTCATCGCCCCCGACTTCGTCTCCGACCTGGCGGGCCTAGGCGGGCCCCAGCAGCAGGCGGCTAAC
GAGGAGTTTATGCTCGCGCTGTCTCTGTGCCACACGGTCATCGCCGAGAGATCGCCCGGCGACCCACCGAGCATG
AACTTCAAGGCGCAGTCGCCCGACGAGGAGGCCCTGGTCGCCACCGCCCGCGACATGGGCTTCACCGTAATCAGC
AACAACAGCGACGGCATCGACCTGAACGTACTGGGCCAGGACCGCCACTACCCGATCCTCAATACGATTGAGTTC
AACTCGAGCAGGAAGCGGATGAGCTCCATCGTGCGCATGCCCGACGGCCAGATCGTCCTCTACTGCAAGGGCGCC
GACTCGGTCATCTACTCGCGCCTCAAGCGGGGCGAGCAGCAGCAGCTGCGGCGCCAGACGGCGGAGCAACTCGAG
ATGTTCGCCCGCGAAGGTCTTCGGACGCTCTGCATCGCGCGCAAGACACTGACGGAGAAGGAGTACGAGATGTGG
AAGAAGGAGCACGACGCGGCGGCGTCGGCGCTCGAGAACCGCGAGGAGAAATTGGAGACGGTGGCAGAGCTCATC
GAGCAGGACCTGATGCTACTGGGCGGCACGGCCATCGAAGATCGCCTGCAGGACGGCGTGCCCGACACCATCGCC
CTCCTCGGCCAGGCCGGCATGAAGCTGTGGGTGCTGACGGGCGACAAGGTCGAGACGGCCATCAACATCGGCTTC
TCGTGCAATCTGCTCAACAACGACATGGAGCTGATCCACCTCAAGCTCGACGAGGACGAGACGGGCGAGACGAGC
GACGAGACGTTCCTGGGCACGACGGAGAAGCTTCTGGAGCAGAACCTGCAGATGTTTGATCTGGTCGGCGACGAC
AGCGACCTTGCGGCGGCGAGGAAGAACCACGAGCCGCCGGCGCCGACGCACGGCCTCGTCATCGATGGCTTCACC
CTCCGCTGGGCCCTCAACGACCGGCTGCGGCAAAAGTTTCTGCTGCTGTGCAAGCAGTGCAAGTCGGTGCTGTGC
TGCCGCGTCAGCCCCGCGCAAAAGGCGGCCGTCGTGGCCATGGTCAAGACGGGGCTGGACGTGATGACGCTGTCG
ATTGGCGACGGTGCCAACGACGTGGCCATGATCCAAGAGGCCGACGTGGGCGTCGGTATCGCTGGTGTCGAGGGT
CGACAGGCGGCCATGTCGTCCGACTACGCCATTGCCCAGTTCCGCTTCCTGCAGAGGCTGATGCTGGTGCACGGC
CGGTGGGACTACCGGCGGCTGGCGGAGAGTATCGCCAACTTCTTCTACAAGAACGTGGTCTGGACCTTTGCCATC
TTCTGGTTCGAGATCTTCTGCGACTTCGACATCACCTACCCCTTCGACTACACCTACATTCTCCTGTTCAACCTC
ATCTTCACGTCGCTCCCCGTCGGCATCATGGGCGTGCTCGACCAGGACGTCTCGGACAAGGTGTCGCTGGCCGTG
CCTCAGCTGTACCGAAGGGGTATCGAACGGCTGGAGTGGACGCACAGCAAGTTTTGGTTTTACATGGTCGACGGC
CTCTACCAGTCCGTCATGGTCTTCTTCATCCCATACCTGCTGTTCGTTCCGGCCCAGCCGGTCAGCTTCTCCGGG
CTCGGCCTCGAGGATAGGCTTCGGTTCGGCGCCTACGTGGCGCATCCCGCCGTGGTGACGATCAACGCCTACATC
CTGATCAACACGTACCGGTGGGATTGGCTGATGCTGCTCGTGGTGAGCCTCAGCGACCTGTCCATCTTCTTCTGG
ACGGGCGTCTACTCGTCCTTTGTCTCGTCGGGCTTCTTCTTCAAGACGGCGGCCGAGGTGTACAGCGAGGCCAGC
TTCTGGGCCATCTTCTTCATCGTCCCCGTCATCTGCCTCTTCCCGCGCTTCGCCGTCAAGTCGCTGCAGAAGGTC
TACTGGCCATACGACGTGGACATTATCCGCGAGCAGGAGAAGATGGGCGCCTTCGCCTACCTGACGGAGGGCAGC
GGATCCAGCAACCGGCACGGCAGCGACGGAGGCAGCCAGAAGTCAGGCAGCTCGAAGAAGGCCAAGCACATACTC
AGCGGCAGCGTCGACGACGACCTGCGGCCCATCTATCCGCCGTCGACGGCGACGCGGACGACGGCCCACAACCGG
ACACAGAACGGCAGCGACTCGACCAACTTTTCGGCCGACGCGTCGCTCGACGCGGCCGTCGCCACGGGCGCTAAT
CGGCTATCAGCGGAGGTGGTGCCTCCGGACCGACGGTCGGACGACCGGGTGAGGCCGTCGTACGACCGGATGCGG
CCGTCGTACGACCGGATGCGCATGTCAATGGATCGCGTCCGGCCGAGCTTCGAGGCGAGCAGCGATTTCACCTCG
GCGGCGCGGCTGCAGCGCATCGAGTCGACGCAAAATGTCGGCTTTAAGGCCAGACTCCGAGGCCTGTCGCTGACC
AAGAACGCGGCGGCGAACTCGCCGCTGAGCCCGCGTTCTCCGCGGTCGCCGAGGACGCGGCGC
Transcript >Ophio5|2334
ATGACCACGGCCAATGGCTCCGGGCCTGGCGCCGACGGCAATCCGCCAAAGATTGAGCGCCCCCATCGGACACGC
TGGGCCACTCGAAAGATGACCATCAAAAGCGGTCGCTCCAAGCGTCTGTCGCTTCTCAACCGCATGCAACAACGG
AAACGCGCATCCAACGAGAAGCCCTCGGCCGGCGACACCTCGGAGCCGCCCCTGACGGACCGCAGTAGCGAAGAC
GGTTCTGATACCTCATCTCAATCGGAAGACAACGGCCGCACCCTCTACTTCAATCTGCCTCTTCCCGACGACCTG
CTGAGCGACGGCCATCCTATCCAAACTTTTCCCCGGAACAAGATTAGGACCGCAAAGTACACACCGCTCTCTTTC
GTGCCCAAGAACCTGTGGTTCCAGTTCCACAATGTGGCCAACATATTTTTCCTTTTCCTCGTCATTCTCGGTATA
TTTCCCATTTTCGGCGGCGTCAACCCCGGTCTCAACGCCGTCCCCCTCATCTTCATCATCGTCGTCACCGCAATC
AAGGACGCAGTCGAGGATTACCGACGTACCGTTCTCGACAACGAACTCAACAATGCCCCCGTCCACCGATTGTCG
CATTGGAACAATGTCAATGTCGAGGAGGGGACCGTCTCGTCCTGGAGGAGGTTTAAAAAGGCCAACACGAGACTG
TTTGGCTCCATGTGGCATGCCATCGAGAGTTTGTGGTCCCAAAAGGCCAGGACGGCCAGGGCTGAGCGCAAGGCG
CGCAAGCTGCAAGAGGCAGACCCGGAGGACGAGGTTCGCCCATCGGTCGAGACGACACGCACCAGAATGTCGGTC
CGTGAGGCTCTCTCCTCGCCCTTCAGCCACGAATCGTTCAAGTCCGCCGATGACGACATCCCCATGACCCCCGTC
GGCTCACCCAAAGCCGTCGGCGACCTGCCCACCCTCGAGCTGCCCGACGACCAAGACGCCAAGCGCGCCGCGTCG
CTGCGGTCCATGAAGTCCGATCTCGTCAACTACCGCCGCGCTCCGGAGGGGGCAAAGTTCAAAAAGGACACCTGG
AAGAGCATCCAGGTCGGCGACTTCGTGCGAATCTACAACGACGACGAGCTGCCCGCCGACGTCATCATCCTGTCC
ACCTCGGACCCCGACGGCGCCTGCTACGTCGAGACGAAGAACCTGGACGGTGAGACGAATCTCAAGGTTCGTCAG
GCTCTCCGCTGCGGCCGCACCCTCAAGCACGCCCGAGACTGCGAGAGGGCCGAGTTCCACATCCAGAGCGAGCCG
CCGCAGCCCAATCTTTACAAGTACAACGGCGCCATCCACTGGAAGCAAAGGGTCCCCGGCTGTCCCGAGGACGAG
CCGGCCAACATGACGGAGCCCATCACCATCGACAACCTGCTTCTTCGCGGCTGTAACCTACGCAACACCGAGTGG
GTGCTCGGCGTCGTCATCTTCACTGGACACGACACAAAGATCATGATGAACGCCGGCATCACCCCCAGCAAGCGC
TCGAGGATCGCCCGCGAGATGAACTTCAACGTCGTTTGTAACTTTGGCATCCTGCTCATCATGTGCCTGCTGTCG
GGCATCTTCAACGGCGTCGCTTGGTCCAAGACGGACGCCTCGCTGCATTTTTTCGACTTTGGTTCCATCGGCGGC
AGCGCCGCTATGAGCGGCTTCATCACCTTCTGGGCCGCCATCATTGTCTTCCAGAACCTGGTGCCCATCTCCCTC
TACATCACGCTCGAGATTGTCCGCACGCTACAGGCCGTTCTCATCTTCAGCGACATCGACATGTACTACGCCAAG
ATCGACCAACCGTGCATCCCCAAGTCGTGGAACATCTCCGATGACGTCGGCCAGATCGAATACATCTTTTCCGAC
AAGACTGGCACGCTCACGCAGAACGTCATGGAGTTCAAGAAGGCCTCCATCAACGGCCAGCCCTACGGTGAGGCC
TTCACGGAGGCGCAGGCTGGTATGCAGAAACGACTCGGCGTCGACGTGGTGGCCGAGGCGGCCAGGATCGAGACC
GAGATTGCCGAGGCCAAAGTCAAAGCACTGGCCGGTCTGCGGAAGCTGTACGACAACCCGTACCTTCACGACGGC
AGCGTCACCTTCATCGCCCCCGACTTCGTCTCCGACCTGGCGGGCCTAGGCGGGCCCCAGCAGCAGGCGGCTAAC
GAGGAGTTTATGCTCGCGCTGTCTCTGTGCCACACGGTCATCGCCGAGAGATCGCCCGGCGACCCACCGAGCATG
AACTTCAAGGCGCAGTCGCCCGACGAGGAGGCCCTGGTCGCCACCGCCCGCGACATGGGCTTCACCGTAATCAGC
AACAACAGCGACGGCATCGACCTGAACGTACTGGGCCAGGACCGCCACTACCCGATCCTCAATACGATTGAGTTC
AACTCGAGCAGGAAGCGGATGAGCTCCATCGTGCGCATGCCCGACGGCCAGATCGTCCTCTACTGCAAGGGCGCC
GACTCGGTCATCTACTCGCGCCTCAAGCGGGGCGAGCAGCAGCAGCTGCGGCGCCAGACGGCGGAGCAACTCGAG
ATGTTCGCCCGCGAAGGTCTTCGGACGCTCTGCATCGCGCGCAAGACACTGACGGAGAAGGAGTACGAGATGTGG
AAGAAGGAGCACGACGCGGCGGCGTCGGCGCTCGAGAACCGCGAGGAGAAATTGGAGACGGTGGCAGAGCTCATC
GAGCAGGACCTGATGCTACTGGGCGGCACGGCCATCGAAGATCGCCTGCAGGACGGCGTGCCCGACACCATCGCC
CTCCTCGGCCAGGCCGGCATGAAGCTGTGGGTGCTGACGGGCGACAAGGTCGAGACGGCCATCAACATCGGCTTC
TCGTGCAATCTGCTCAACAACGACATGGAGCTGATCCACCTCAAGCTCGACGAGGACGAGACGGGCGAGACGAGC
GACGAGACGTTCCTGGGCACGACGGAGAAGCTTCTGGAGCAGAACCTGCAGATGTTTGATCTGGTCGGCGACGAC
AGCGACCTTGCGGCGGCGAGGAAGAACCACGAGCCGCCGGCGCCGACGCACGGCCTCGTCATCGATGGCTTCACC
CTCCGCTGGGCCCTCAACGACCGGCTGCGGCAAAAGTTTCTGCTGCTGTGCAAGCAGTGCAAGTCGGTGCTGTGC
TGCCGCGTCAGCCCCGCGCAAAAGGCGGCCGTCGTGGCCATGGTCAAGACGGGGCTGGACGTGATGACGCTGTCG
ATTGGCGACGGTGCCAACGACGTGGCCATGATCCAAGAGGCCGACGTGGGCGTCGGTATCGCTGGTGTCGAGGGT
CGACAGGCGGCCATGTCGTCCGACTACGCCATTGCCCAGTTCCGCTTCCTGCAGAGGCTGATGCTGGTGCACGGC
CGGTGGGACTACCGGCGGCTGGCGGAGAGTATCGCCAACTTCTTCTACAAGAACGTGGTCTGGACCTTTGCCATC
TTCTGGTTCGAGATCTTCTGCGACTTCGACATCACCTACCCCTTCGACTACACCTACATTCTCCTGTTCAACCTC
ATCTTCACGTCGCTCCCCGTCGGCATCATGGGCGTGCTCGACCAGGACGTCTCGGACAAGGTGTCGCTGGCCGTG
CCTCAGCTGTACCGAAGGGGTATCGAACGGCTGGAGTGGACGCACAGCAAGTTTTGGTTTTACATGGTCGACGGC
CTCTACCAGTCCGTCATGGTCTTCTTCATCCCATACCTGCTGTTCGTTCCGGCCCAGCCGGTCAGCTTCTCCGGG
CTCGGCCTCGAGGATAGGCTTCGGTTCGGCGCCTACGTGGCGCATCCCGCCGTGGTGACGATCAACGCCTACATC
CTGATCAACACGTACCGGTGGGATTGGCTGATGCTGCTCGTGGTGAGCCTCAGCGACCTGTCCATCTTCTTCTGG
ACGGGCGTCTACTCGTCCTTTGTCTCGTCGGGCTTCTTCTTCAAGACGGCGGCCGAGGTGTACAGCGAGGCCAGC
TTCTGGGCCATCTTCTTCATCGTCCCCGTCATCTGCCTCTTCCCGCGCTTCGCCGTCAAGTCGCTGCAGAAGGTC
TACTGGCCATACGACGTGGACATTATCCGCGAGCAGGAGAAGATGGGCGCCTTCGCCTACCTGACGGAGGGCAGC
GGATCCAGCAACCGGCACGGCAGCGACGGAGGCAGCCAGAAGTCAGGCAGCTCGAAGAAGGCCAAGCACATACTC
AGCGGCAGCGTCGACGACGACCTGCGGCCCATCTATCCGCCGTCGACGGCGACGCGGACGACGGCCCACAACCGG
ACACAGAACGGCAGCGACTCGACCAACTTTTCGGCCGACGCGTCGCTCGACGCGGCCGTCGCCACGGGCGCTAAT
CGGCTATCAGCGGAGGTGGTGCCTCCGGACCGACGGTCGGACGACCGGGTGAGGCCGTCGTACGACCGGATGCGG
CCGTCGTACGACCGGATGCGCATGTCAATGGATCGCGTCCGGCCGAGCTTCGAGGCGAGCAGCGATTTCACCTCG
GCGGCGCGGCTGCAGCGCATCGAGTCGACGCAAAATGTCGGCTTTAAGGCCAGACTCCGAGGCCTGTCGCTGACC
AAGAACGCGGCGGCGAACTCGCCGCTGAGCCCGCGTTCTCCGCGGTCGCCGAGGACGCGGCGCTAA
Gene >Ophio5|2334
ATGACCACGGCCAATGGCTCCGGGCCTGGCGCCGACGGCAATCCGCCAAAGATTGAGCGCCCCCATCGGACACGC
TGGGCCACTCGAAAGATGACCATCAAAAGCGGTCGCTCCAAGCGTCTGTCGCTTCTCAACCGCATGCAACAACGG
AAACGCGCATCCAACGAGAAGCCCTCGGCCGGCGACACCTCGGAGCCGCCCCTGACGGACCGCAGTAGCGAAGAC
GGTTCTGATACCTCATCTCAATCGGAAGACAACGGCCGCACCCTCTACTTCAATCTGCCTCTTCCCGACGACCTG
CTGAGCGACGGCCATCCTATCCAAACTTTTCCCCGGAACAAGATTAGGACCGCAAAGTACACACCGCTCTCTTTC
GTGCCCAAGAACCTGTGGTTCCAGTTCCACAATGTGGCCAACATATTTTTCCTTTTCCTCGTCATTCTCGGTGTG
AGTAAATCCTTGTCCTCCCCCTGAACCCCTCGCCTCGCCTCGTCTCGTCCCGCACCCATTGCCGTCGGCCGGATC
GTTAATCCTCCCCTTTTCCGCAGATATTTCCCATTTTCGGCGGCGTCAACCCCGGTCTCAACGCCGTCCCCCTCA
TCTTCATCATCGTCGTCACCGCAATCAAGGACGCAGTCGAGGATTACCGACGTACCGTTCTCGACAACGAACTCA
ACAATGCCCCCGTCCACCGATTGTCGCATTGGAACAATGTCAATGTCGAGGAGGGGACCGTCTCGTCCTGGAGGA
GGTTTAAAAAGGCCAACACGAGACTGTTTGGCTCCATGTGGCATGCCATCGAGAGTTTGTGGTCCCAAAAGGCCA
GGACGGCCAGGGCTGAGCGCAAGGCGCGCAAGCTGCAAGAGGCAGACCCGGAGGACGAGGTTCGCCCATCGGTCG
AGACGACACGCACCAGAATGTCGGTCCGTGAGGCTCTCTCCTCGCCCTTCAGCCACGAATCGTTCAAGTCCGCCG
ATGACGACATCCCCATGACCCCCGTCGGCTCACCCAAAGCCGTCGGCGACCTGCCCACCCTCGAGCTGCCCGACG
ACCAAGACGCCAAGCGCGCCGCGTCGCTGCGGTCCATGAAGTCCGATCTCGTCAACTACCGCCGCGCTCCGGAGG
GGGCAAAGTTCAAAAAGGACACCTGGAAGAGCATCCAGGTCGGCGACTTCGTGCGAATCTACAACGACGACGAGC
TGCCCGCCGACGTCATCATCCTGTCCACCTCGGACCCCGACGGCGCCTGCTACGTCGAGACGAAGAACCTGGACG
GTGAGACGAATCTCAAGGTTCGTCAGGCTCTCCGCTGCGGCCGCACCCTCAAGCACGCCCGAGACTGCGAGAGGG
CCGAGTTCCACATCCAGAGCGAGCCGCCGCAGCCCAATCTTTACAAGTACAACGGCGCCATCCACTGGAAGCAAA
GGGTCCCCGGCTGTCCCGAGGACGAGCCGGCCAACATGACGGAGCCCATCACCATCGACAACCTGCTTCTTCGCG
GCTGTAACCTACGCAACACCGAGTGGGTGCTCGGCGTCGTCATCTTCACTGGACACGACACAAAGATCATGATGA
ACGCCGGCATCACCCCCAGCAAGCGCTCGAGGATCGCCCGCGAGATGAACTTCAACGTCGTTTGTAACTTTGGCA
TCCTGCTCATCATGTGCCTGCTGTCGGGCATCTTCAACGGCGTCGCTTGGTCCAAGACGGACGCCTCGCTGCATT
TTTTCGACTTTGGTTCCATCGGCGGCAGCGCCGCTATGAGCGGCTTCATCACCTTCTGGGCCGCCATCATTGTCT
TCCAGAACCTGGTGCCCATCTCCCTCTACATCACGCTCGAGATTGTCCGCACGCTACAGGCCGTTCTCATCTTCA
GCGACATCGACATGTACTACGCCAAGATCGACCAACCGTGCATCCCCAAGTCGTGGAACATCTCCGATGACGTCG
GCCAGATCGAATACATCTTTTCCGACAAGACTGGCACGCTCACGCAGAACGTCATGGAGTTCAAGAAGGCCTCCA
TCAACGGCCAGCCCTACGGTGAGGCCTTCACGGAGGCGCAGGCTGGTATGCAGAAACGACTCGGCGTCGACGTGG
TGGCCGAGGCGGCCAGGATCGAGACCGAGATTGCCGAGGCCAAAGTCAAAGCACTGGCCGGTCTGCGGAAGCTGT
ACGACAACCCGTACCTTCACGACGGCAGCGTCACCTTCATCGCCCCCGACTTCGTCTCCGACCTGGCGGGCCTAG
GCGGGCCCCAGCAGCAGGCGGCTAACGAGGAGTTTATGCTCGCGCTGTCTCTGTGCCACACGGTCATCGCCGAGA
GATCGCCCGGCGACCCACCGAGCATGAACTTCAAGGCGCAGTCGCCCGACGAGGAGGCCCTGGTCGCCACCGCCC
GCGACATGGGCTTCACCGTAATCAGCAACAACAGCGACGGCATCGACCTGAACGTACTGGGCCAGGACCGCCACT
ACCCGATCCTCAATACGATTGAGTTCAACTCGAGCAGGAAGCGGATGAGCTCCATCGTGCGCATGCCCGACGGCC
AGATCGTCCTCTACTGCAAGGGCGCCGACTCGGTCATCTACTCGCGCCTCAAGCGGGGCGAGCAGCAGCAGCTGC
GGCGCCAGACGGCGGAGCAACTCGAGATGTTCGCCCGCGAAGGTCTTCGGACGCTCTGCATCGCGCGCAAGACAC
TGACGGAGAAGGAGTACGAGATGTGGAAGAAGGAGCACGACGCGGCGGCGTCGGCGCTCGAGAACCGCGAGGAGA
AATTGGAGACGGTGGCAGAGCTCATCGAGCAGGACCTGATGCTACTGGGCGGCACGGCCATCGAAGATCGCCTGC
AGGACGGCGTGCCCGACACCATCGCCCTCCTCGGCCAGGCCGGCATGAAGCTGTGGGTGCTGACGGGCGACAAGG
TCGAGACGGCCATCAACATCGGCTTCTCGTGCAATCTGCTCAACAACGACATGGAGCTGATCCACCTCAAGCTCG
ACGAGGACGAGACGGGCGAGACGAGCGACGAGACGTTCCTGGGCACGACGGAGAAGCTTCTGGAGCAGAACCTGC
AGATGTTTGATCTGGTCGGCGACGACAGCGACCTTGCGGCGGCGAGGAAGAACCACGAGCCGCCGGCGCCGACGC
ACGGCCTCGTCATCGATGGCTTCACCCTCCGCTGGGCCCTCAACGACCGGCTGCGGCAAAAGTTTCTGCTGCTGT
GCAAGCAGTGCAAGTCGGTGCTGTGCTGCCGCGTCAGCCCCGCGCAAAAGGCGGCCGTCGTGGCCATGGTCAAGA
CGGGGCTGGACGTGATGACGCTGTCGATTGGCGACGGTGCCAACGACGTGGCCATGATCCAAGAGGCCGACGTGG
GCGTCGGTATCGCTGGTGTCGAGGGTCGACAGGCGGCCATGTCGTCCGACTACGCCATTGCCCAGTTCCGCTTCC
TGCAGAGGCTGATGCTGGTGCACGGCCGGTGGGACTACCGGCGGCTGGCGGAGAGTATCGCCAACTTCTTCTACA
AGAACGTGGTCTGGACCTTTGCCATCTTCTGGTTCGAGATCTTCTGCGACTTCGACATCACCTACCCCTTCGACT
ACACCTACATTCTCCTGTTCAACCTCATCTTCACGTCGCTCCCCGTCGGCATCATGGGCGTGCTCGACCAGGACG
TCTCGGACAAGGTGTCGCTGGCCGTGCCTCAGCTGTACCGAAGGGGTATCGAACGGCTGGAGTGGACGCACAGCA
AGTTTTGGTGAGTGCAGAGACGGACCCCGATTCTCTAACCTGCGGCGGCTAACGAAAGCACAGGTTTTACATGGT
CGACGGCCTCTACCAGTCCGTCATGGTCTTCTTCATCCCATACCTGCTGTTCGTTCCGGCCCAGCCGGTCAGCTT
CTCCGGGCTCGGCCTCGAGGATAGGCTTCGGTTCGGCGCCTACGTGGCGCATCCCGCCGTGGTGACGATCAACGC
CTACATCCTGATCAACACGTACCGGTGGGATTGGCTGATGCTGCTCGTGGTGAGCCTCAGCGACCTGTCCATCTT
CTTCTGGACGGGCGTCTACTCGTCCTTTGTCTCGTCGGGCTTCTTCTTCAAGACGGCGGCCGAGGTGTACAGCGA
GGCCAGCTTCTGGGCCATCTTCTTCATCGTCCCCGTCATCTGCCTCTTCCCGCGCTTCGCCGTCAAGTCGCTGCA
GAAGGTCTACTGGCCATACGACGTGGACATTATCCGCGAGCAGGAGAAGATGGGCGCCTTCGCCTACCTGACGGA
GGGCAGCGGATCCAGCAACCGGCACGGCAGCGACGGAGGCAGCCAGAAGTCAGGCAGCTCGAAGAAGGCCAAGCA
CATACTCAGCGGCAGCGTCGACGACGACCTGCGGCCCATCTATCCGCCGTCGACGGCGACGCGGACGACGGCCCA
CAACCGGACACAGAACGGCAGCGACTCGACCAACTTTTCGGCCGACGCGTCGCTCGACGCGGCCGTCGCCACGGG
CGCTAATCGGCTATCAGCGGAGGTGGTGCCTCCGGACCGACGGTCGGACGACCGGGTGAGGCCGTCGTACGACCG
GATGCGGCCGTCGTACGACCGGATGCGCATGTCAATGGATCGCGTCCGGCCGAGCTTCGAGGCGAGCAGCGATTT
CACCTCGGCGGCGCGGCTGCAGCGCATCGAGTCGACGCAAAATGTCGGCTTTAAGGCCAGACTCCGAGGCCTGTC
GCTGACCAAGAACGCGGCGGCGAACTCGCCGCTGAGCCCGCGTTCTCCGCGGTCGCCGAGGACGCGGCGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail